Align Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 (characterized)
to candidate WP_072906909.1 BUB13_RS06345 diaminopimelate epimerase
Query= SwissProt::Q81XR2 (288 letters) >NCBI__GCF_900142125.1:WP_072906909.1 Length = 279 Score = 281 bits (720), Expect = 9e-81 Identities = 140/276 (50%), Positives = 184/276 (66%), Gaps = 5/276 (1%) Query: 6 FTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAPVKMRM 65 FTKMHG GN Y+Y+N FEE++ +D +++++VSN N GIG+DG+ILI PSD A V+MRM Sbjct: 3 FTKMHGAGNDYVYINCFEEKV--DDPVILSQRVSNRNFGIGSDGLILIMPSDKADVRMRM 60 Query: 66 FNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEV-TVEEGKVTLAKID 124 FN DGSEG+ CGNG+RCVAKY Y+H LV+ +ET G++ ++ T G V ++ Sbjct: 61 FNPDGSEGEMCGNGIRCVAKYVYDHGLVKKLNIDVETGNGVLALDLFTGGSGLVERVSVN 120 Query: 125 MGAPRLTRAEIPMLGEGETPFIRENFLYNNHRYAFTAVSMGNPHAVIFVDDVEQAPLTTL 184 MG P+L R+E+PM G I T +SMGNPH V+FVDDVE L T+ Sbjct: 121 MGPPKLMRSELPMTGPANEQAIAVTLPLAQGEVEATCLSMGNPHCVVFVDDVENCALETI 180 Query: 185 GPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAVVASILNGKME 244 GP+LE HE FP R+NVEF++++N E+ R WERG+G T ACGTGA A VA +L G+ E Sbjct: 181 GPLLENHEYFPNRINVEFVQVVNRTEVIQRTWERGAGETLACGTGASAVTVAGVLTGRTE 240 Query: 245 RGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRG 280 R +I HL GGDL + W EEG V+M GPA + G Sbjct: 241 R--KIINHLRGGDLQMEWLEEGPVMMTGPAVEVFSG 274 Lambda K H 0.318 0.136 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 279 Length adjustment: 26 Effective length of query: 262 Effective length of database: 253 Effective search space: 66286 Effective search space used: 66286 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate WP_072906909.1 BUB13_RS06345 (diaminopimelate epimerase)
to HMM TIGR00652 (dapF: diaminopimelate epimerase (EC 5.1.1.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00652.hmm # target sequence database: /tmp/gapView.2835.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00652 [M=270] Accession: TIGR00652 Description: DapF: diaminopimelate epimerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-97 310.5 0.2 6.3e-97 310.2 0.2 1.0 1 lcl|NCBI__GCF_900142125.1:WP_072906909.1 BUB13_RS06345 diaminopimelate ep Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900142125.1:WP_072906909.1 BUB13_RS06345 diaminopimelate epimerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 310.2 0.2 6.3e-97 6.3e-97 1 267 [. 1 275 [. 1 277 [. 0.93 Alignments for each domain: == domain 1 score: 310.2 bits; conditional E-value: 6.3e-97 TIGR00652 1 meFlkmhGlgNdFvlvdevdeelvkeeaelvrkvcdrhtgvgaDgvllvepsseeadvklrifNsDGSe 69 m+F+kmhG+gNd+v+++ ++ e+v l ++v++r++g+g+Dg++l+ p s++adv++r+fN DGSe lcl|NCBI__GCF_900142125.1:WP_072906909.1 1 MKFTKMHGAGNDYVYINCFE-EKVDDPVILSQRVSNRNFGIGSDGLILIMP-SDKADVRMRMFNPDGSE 67 89******************.5555557899*******************8.***************** PP TIGR00652 70 aemCGNgiRcfakfvyekglkekkelsvetlaglikveveeen....kkvkvdmgepkfkkeeiplt.. 132 emCGNgiRc+ak+vy++gl++k ++ vet +g++ + + + + ++v+v+mg pk+ ++e p+t lcl|NCBI__GCF_900142125.1:WP_072906909.1 68 GEMCGNGIRCVAKYVYDHGLVKKLNIDVETGNGVLALDLFTGGsglvERVSVNMGPPKLMRSELPMTgp 136 ****************************************99999999*******************54 PP TIGR00652 133 vekeeekeellalev.....lvvdvGnPHlvvfvedvekldleelgklleaheefpegvNvefvevkke 196 +++++ + l l+ ++++GnPH+vvfv+dve+ +le++g+lle+he fp+++Nvefv+v+++ lcl|NCBI__GCF_900142125.1:WP_072906909.1 137 ANEQAI-AVTLPLAQgeveaTCLSMGNPHCVVFVDDVENCALETIGPLLENHEYFPNRINVEFVQVVNR 204 333333.33333333564544************************************************ PP TIGR00652 197 deiklrvyERGageTlaCGtGavAsavvalklgktkkkvtvhleggeLeievkedgkvyltGpavlvle 265 e++ r++ERGageTlaCGtGa A+ v+++ +g+t++k+ hl+gg+L++e+ e+g v++tGpav v++ lcl|NCBI__GCF_900142125.1:WP_072906909.1 205 TEVIQRTWERGAGETLACGTGASAVTVAGVLTGRTERKIINHLRGGDLQMEWLEEGPVMMTGPAVEVFS 273 ********************************************************************9 PP TIGR00652 266 ge 267 g+ lcl|NCBI__GCF_900142125.1:WP_072906909.1 274 GD 275 97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (279 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 8.06 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory