Align histidinol-phosphate aminotransferase (EC 2.6.1.9) (characterized)
to candidate WP_072908153.1 BUB13_RS09200 histidinol-phosphate transaminase
Query= reanno::Marino:GFF2483 (350 letters) >NCBI__GCF_900142125.1:WP_072908153.1 Length = 349 Score = 231 bits (589), Expect = 2e-65 Identities = 137/336 (40%), Positives = 201/336 (59%), Gaps = 11/336 (3%) Query: 9 VNDLVPYVPGEQPKMANLVKLNTNENPFGPSPKVIEAIQAELN---DGLRLYPDPEGESL 65 + ++ YVPG QP+ +KLNTNENP+ PS KV EAI AEL + LR YPD + Sbjct: 8 IAEMAGYVPGFQPQEDGWIKLNTNENPYPPSAKVREAIIAELGAEGESLRKYPDAASKEA 67 Query: 66 RETIAAYHKITPEQIFLGNGSDEVLAHIFFGLFQHGEPILFPDITYSFYPVYCGLYNIES 125 R A +K+ PE + + NGSDE+L ++ GE + + +YS+Y + + Sbjct: 68 RAVAARLYKVDPEWVIMANGSDELLNNLIRAFAGEGEEVGYIHPSYSYYATLTEIQGAKI 127 Query: 126 KKVPLTESFEINPEDFKQPNGGVIF--PNPNAPTGRYLELQYVEEILAANPNRVVVVDEA 183 + LT+ F+I DF + G +F +PNAP G + Y+EE LA V+VVDEA Sbjct: 128 RTFGLTDDFKI--ADFPERYEGKLFFLTSPNAPLGFIFDNAYIEE-LAQRCAGVLVVDEA 184 Query: 184 YIDFGGESAITLVDKYPNLLVSQTLSKARSLAGLRVGFAVGHPDLIEALNRVKNSFNSYP 243 Y+DF SA+ LV K+ N++V++T SK+ SLAG+R+G AV P++I AL+++++ Y Sbjct: 185 YVDFADSSAMQLVKKHENIVVTRTFSKSYSLAGMRLGLAVARPEVIAALDKIRDH---YH 241 Query: 244 LDRLALAGAKAAYEDEAWFRKCCDGVISERERVTAVLEGLGFEVLPSKANFIFARHKEQP 303 LDRLAL A AA ED+ R D V + R+ + L LG+EV+PS NF+FA ++ Sbjct: 242 LDRLALVAATAALEDQEQLRLNVDRVCNVRDCFSNELRKLGYEVIPSHGNFVFAVPSDRD 301 Query: 304 GEVLAKGLREQGIIVRHFNKPRISEFLRITIGTVEQ 339 G+ + L E+ I+VR+F+ P + LRITIGT E+ Sbjct: 302 GKRVYDALFERKILVRYFSDPLLKHGLRITIGTREE 337 Lambda K H 0.319 0.139 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 350 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 349 Length adjustment: 29 Effective length of query: 321 Effective length of database: 320 Effective search space: 102720 Effective search space used: 102720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_072908153.1 BUB13_RS09200 (histidinol-phosphate transaminase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.16705.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-99 319.2 0.0 1.6e-99 319.1 0.0 1.0 1 lcl|NCBI__GCF_900142125.1:WP_072908153.1 BUB13_RS09200 histidinol-phospha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900142125.1:WP_072908153.1 BUB13_RS09200 histidinol-phosphate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 319.1 0.0 1.6e-99 1.6e-99 1 349 [] 5 348 .. 5 348 .. 0.94 Alignments for each domain: == domain 1 score: 319.1 bits; conditional E-value: 1.6e-99 TIGR01141 1 rekikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelk....klhrYpdpqalelkeala 65 r++i +++ Y+pg + e++ +kLn+nEnP++ps kv+ea+ +el +l++Ypd+ ++e ++ +a lcl|NCBI__GCF_900142125.1:WP_072908153.1 5 RKNIAEMAGYVPGFQP-QEDGWIKLNTNENPYPPSAKVREAIIAELGaegeSLRKYPDAASKEARAVAA 72 789*********9444.44489********************999988888****************** PP TIGR01141 66 kylgveeenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedle 134 + ++v++e ++++nGsdel++ liraf+ +g++v +++p+ys+Y++ ++i+ga++++ l++d+ + + lcl|NCBI__GCF_900142125.1:WP_072908153.1 73 RLYKVDPEWVIMANGSDELLNNLIRAFAGEGEEVGYIHPSYSYYATLTEIQGAKIRTFGLTDDF--KIA 139 ***************************************************************4..333 PP TIGR01141 135 avleaakekvklvflasPnnPtGnllkreeiekvleevedalVVvDeAYieFseeasvlellaeypnlv 203 ++ + + kl fl+sPn+P G +++++ ie+++++ ++ VvDeAY++F+++ s+++l+++++n+v lcl|NCBI__GCF_900142125.1:WP_072908153.1 140 DFP--ERYEGKLFFLTSPNAPLGFIFDNAYIEELAQRC-AGVLVVDEAYVDFADS-SAMQLVKKHENIV 204 443..55689***************************9.8999***********6.************* PP TIGR01141 204 vlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkkerer 272 v+rT+SK+++LAg+R+G+a+a +e+i al+k+r+ y++++lal aa+aal+d+++++ +v++v + r+ lcl|NCBI__GCF_900142125.1:WP_072908153.1 205 VTRTFSKSYSLAGMRLGLAVARPEVIAALDKIRDHYHLDRLALVAATAALEDQEQLRLNVDRVCNVRDC 273 ********************************************************************* PP TIGR01141 273 lleelkkleglevyeSkaNFvlikvke.daeelleallekgiivRdlksaeglleeclRitvGtreene 340 +el+kl g ev++S++NFv++ + d +++++al e++i+vR+++ ++ll++ lRit+Gtree+ lcl|NCBI__GCF_900142125.1:WP_072908153.1 274 FSNELRKL-GYEVIPSHGNFVFAVPSDrDGKRVYDALFERKILVRYFS--DPLLKHGLRITIGTREEMM 339 ********.8***********9854446*******************9..5689*************** PP TIGR01141 341 rllealkei 349 ++ eal ei lcl|NCBI__GCF_900142125.1:WP_072908153.1 340 KIKEALTEI 348 *99999876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (349 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.88 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory