Align Aromatic-amino-acid transaminase (EC 2.6.1.57) (characterized)
to candidate WP_072908153.1 BUB13_RS09200 histidinol-phosphate transaminase
Query= reanno::BFirm:BPHYT_RS14905 (370 letters) >NCBI__GCF_900142125.1:WP_072908153.1 Length = 349 Score = 154 bits (388), Expect = 5e-42 Identities = 106/329 (32%), Positives = 175/329 (53%), Gaps = 27/329 (8%) Query: 37 VKLASNENPLGMPESAQRAM-AQAASE---LGRYPDANAFELKAALSERYGVPADWVTLG 92 +KL +NENP + A+ A+ +E L +YPDA + E +A + Y V +WV + Sbjct: 26 IKLNTNENPYPPSAKVREAIIAELGAEGESLRKYPDAASKEARAVAARLYKVDPEWVIMA 85 Query: 93 NGSNDILEIAAHAFVEKGQSIVYAQYSFAVYALATQGLGARAIVVPAVKYGHDLDAMLAA 152 NGS+++L AF +G+ + Y S++ YA T+ GA+ +G D +A Sbjct: 86 NGSDELLNNLIRAFAGEGEEVGYIHPSYSYYATLTEIQGAKIRT-----FGLTDDFKIAD 140 Query: 153 VSD--DTRLIFVANPNNPTGTFIEGPKLEAFLDKVPRHVVVVLDEAYTEYLPQEKRYDSI 210 + + +L F+ +PN P G + +E + V+V+DEAY ++ ++ Sbjct: 141 FPERYEGKLFFLTSPNAPLGFIFDNAYIEELAQRCAG--VLVVDEAYVDFADSS----AM 194 Query: 211 AWVRRYPNLLVSRTFSKAFGLAGLRVGFAIAQPELTDLLNRVRQPFNVNTLAQAAAIAAL 270 V+++ N++V+RTFSK++ LAG+R+G A+A+PE+ L+++R ++++ LA AA AAL Sbjct: 195 QLVKKHENIVVTRTFSKSYSLAGMRLGLAVARPEVIAALDKIRDHYHLDRLALVAATAAL 254 Query: 271 NDKAFLEKSAALNAQGYRRLTEAFD----KLGLEYVPSDGNFVLVRVGNDDAAGNRVNLE 326 D ++ LN + + F KLG E +PS GNFV + D G RV Sbjct: 255 ED----QEQLRLNVDRVCNVRDCFSNELRKLGYEVIPSHGNFVFAVPSDRD--GKRVYDA 308 Query: 327 LLKQGVIVRPVGNYGLPQWLRITIGLPEE 355 L ++ ++VR + L LRITIG EE Sbjct: 309 LFERKILVRYFSDPLLKHGLRITIGTREE 337 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 349 Length adjustment: 29 Effective length of query: 341 Effective length of database: 320 Effective search space: 109120 Effective search space used: 109120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory