Align (R)-citramalate synthase (EC 2.3.3.21) (characterized)
to candidate WP_072910006.1 BUB13_RS17220 homocitrate synthase
Query= BRENDA::Q58787 (491 letters) >NCBI__GCF_900142125.1:WP_072910006.1 Length = 375 Score = 271 bits (692), Expect = 4e-77 Identities = 144/343 (41%), Positives = 211/343 (61%) Query: 5 IFDTTLRDGEQTPGVSLTPNDKLEIAKKLDELGVDVIEAGSAITSKGEREGIKLITKEGL 64 I DTTLRDGEQT GV+ + +K IA+ LDE+GV +E G + E+ I+ + GL Sbjct: 11 IDDTTLRDGEQTAGVAFSLEEKKRIARMLDEIGVGELECGIPAMGEQEQASIRALVDMGL 70 Query: 65 NAEICSFVRALPVDIDAALECDVDSVHLVVPTSPIHMKYKLRKTEDEVLETALKAVEYAK 124 NA + ++ RA+ DI+A+L+ V++V + + S HMK+KL K+ V E A+ +AK Sbjct: 71 NARLMTWNRAVISDIEASLKTGVEAVDISLSVSDQHMKHKLGKSRQWVKEQLKVALGFAK 130 Query: 125 EHGLIVELSAEDATRSDVNFLIKLFNEGEKVGADRVCVCDTVGVLTPQKSQELFKKITEN 184 +H L V + ED++R+D++FL++L E GADR CDT+G+L P + + K + + Sbjct: 131 KHNLYVSVGGEDSSRADLDFLVELLQIAENEGADRFRFCDTLGILDPFATYGMVKYLYDR 190 Query: 185 VNLPVSVHCHNDFGMATANTCSAVLGGAVQCHVTVNGIGERAGNASLEEVVAALKILYGY 244 L + VH HND GMATAN + + GA + TVNG+GERAGNA+LEEVV ALK G Sbjct: 191 TGLDLEVHTHNDLGMATANAIAGIRAGARFVNTTVNGLGERAGNAALEEVVMALKHACGR 250 Query: 245 DTKIKMEKLYEVSRIVSRLMKLPVPPNKAIVGDNAFAHEAGIHVDGLIKNTETYEPIKPE 304 D I + E+SR VS+ PVP KA+VG+ F+HE+G+H DG+IK+ YE P Sbjct: 251 DPHIDTSRFVEISRYVSQASHHPVPDWKAVVGEKVFSHESGLHADGVIKDARNYEGFDPA 310 Query: 305 MVGNRRRIILGKHSGRKALKYKLDLMGINVSDEQLNKIYERVK 347 VG +R ++LGKHSG L +L + I+ ++ + +V+ Sbjct: 311 EVGLQRYMVLGKHSGSHGLLQRLKQLDIDPQQLDVDALLSQVR 353 Lambda K H 0.316 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 454 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 491 Length of database: 375 Length adjustment: 32 Effective length of query: 459 Effective length of database: 343 Effective search space: 157437 Effective search space used: 157437 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory