Align aspartate transaminase (EC 2.6.1.1) (characterized)
to candidate WP_073036684.1 BUB04_RS02665 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::Q8YMS6 (388 letters) >NCBI__GCF_900129305.1:WP_073036684.1 Length = 398 Score = 410 bits (1055), Expect = e-119 Identities = 204/392 (52%), Positives = 282/392 (71%), Gaps = 10/392 (2%) Query: 1 MKLAARVSQVTPSITLAIAAKAKAMKAEGIDVCSFSAGEPDFDTPAHIKAAAAKALDEGK 60 MKL+ RVSQV PS TLAI AKAKA++AEG V SF GEPDFDTP HI A +A+ G+ Sbjct: 1 MKLSQRVSQVQPSATLAINAKAKALRAEGKQVISFGVGEPDFDTPHHIGEMAVQAVRRGQ 60 Query: 61 TKYGAAAGEPKLREAIARKLQKDNHLDYKPENVIVTNGGKHSLYNLIVALIDPGDEVIIP 120 T+Y A G P+L++AI ++ D LDY PE V+V+ GGKHSLYNL A++DPGD+VIIP Sbjct: 61 TRYTAVQGIPELKDAILDTIRADYGLDYLPEEVLVSCGGKHSLYNLFQAVLDPGDQVIIP 120 Query: 121 APYWLSYPEMVTLVGGKSVIVPTDASTGYKITPEQLRKAITPKTKLFVLNSPSNPTGMVY 180 APYW+SYP+MV L G + VIV S +K+ PE LR+A+T +T++ +LNSPSNPTG+ Y Sbjct: 121 APYWVSYPDMVRLAGAEPVIVDCPESASFKLDPESLRRAVTARTRMLILNSPSNPTGVHY 180 Query: 181 TPEEIKALAQVVVD-ADIYVVSDEIYEKILYDGAQHISIGSLGKEIFNRTLISNGFAKAY 239 PEE+KALA+V++D ++ +VSD+IY ++LY+GAQ +I + + RT I NG +K Y Sbjct: 181 KPEELKALAEVLLDHPEVIIVSDDIYYRMLYNGAQWANIAMVEPRLKERTFIVNGVSKTY 240 Query: 240 SMTGWRLGYLAGPVDIIKAASSIQGHSTSNVCTFAQYGAIAALEDSQDCVEEMRQAFAKR 299 +MTGWR+GY+ G ++IKAA IQ STSN C+ AQ+ A+AAL SQ+ V++M +AF++R Sbjct: 241 AMTGWRIGYMLGDAEVIKAAGKIQSQSTSNPCSVAQWAAVAALRGSQESVQDMLEAFSQR 300 Query: 300 RQVMLDRLNAIPGLSTAKPDGAFYLFPDISKTGLK---------SLEFCDALIEEHKVAV 350 R +++RL +PG++ +P GAFY+FP++S K SL+ D L+EE +AV Sbjct: 301 RDYVMERLGRLPGVTCPEPQGAFYVFPNVSAYYGKTVGSRSIGGSLDLADYLMEEAHLAV 360 Query: 351 IPGIAFGADDNIRLSYATDLATIEKGLDRLEK 382 +PG+AFG D IRLS+A +A +++G DRLEK Sbjct: 361 VPGVAFGGDRCIRLSFALSMAELKEGFDRLEK 392 Lambda K H 0.317 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 398 Length adjustment: 31 Effective length of query: 357 Effective length of database: 367 Effective search space: 131019 Effective search space used: 131019 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory