Align Indole-3-glycerol phosphate synthase; Short=IGPS; EC 4.1.1.48 (characterized, see rationale)
to candidate WP_073037578.1 BUB04_RS05065 indole-3-glycerol phosphate synthase TrpC
Query= uniprot:E4PQZ8_MARAH (273 letters) >NCBI__GCF_900129305.1:WP_073037578.1 Length = 267 Score = 209 bits (533), Expect = 4e-59 Identities = 111/257 (43%), Positives = 162/257 (63%), Gaps = 1/257 (0%) Query: 12 ILRRIVDRKWEEIDERKRQVSIADLKAKARDQPAARGFANALRSRIEQQTPAVIAEIKKA 71 ILR+I++ K +E++E KR+ ++ ++ +A + P R F +L S + VIAEIK+A Sbjct: 3 ILRKILEVKAQEVEEAKRREPLSAVRRRAEESPPTRPFLESL-SAPGPEGVNVIAEIKRA 61 Query: 72 SPSKGILRDPFEPAVIAESYEKGGAACLSVLTDRDFFQGDEDYLVAARNACSLPVIRKDF 131 SPSKG +R +P A +Y++ GAA LSVLTD FFQG L AR A +PV+RKDF Sbjct: 62 SPSKGTIRAGLDPRAYARAYQRAGAAALSVLTDERFFQGSFRDLQVAREAVEVPVLRKDF 121 Query: 132 MVAPYQVYESRAIGADCILLIAACLTKDQMQELEGIAHEIGLDVLVEVHDGEELDDALTL 191 + YQ+YE+RA+GAD +LLI + D +++ + E+GL LVEVHD E++ AL Sbjct: 122 TIDEYQIYEARAVGADAVLLIVRAVPPDFLRDALSLCRELGLGALVEVHDEREMETALAR 181 Query: 192 TTPLVGINNRNLHTFDVSLDTTFDLHERISQDRLTITESGIMTRSDVEAMTARGIYGFLV 251 PL+G+NNR+L TF ++T+ L +++ + ESGI R DVE + GI+ FLV Sbjct: 182 GAPLIGVNNRDLTTFRTDIETSIRLRKQLPAGMPMVAESGIGGREDVERLLDAGIFNFLV 241 Query: 252 GESFMRAEEPGQKLQEL 268 GES +RA +P L+ L Sbjct: 242 GESLVRAPDPETALRSL 258 Lambda K H 0.320 0.136 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 267 Length adjustment: 25 Effective length of query: 248 Effective length of database: 242 Effective search space: 60016 Effective search space used: 60016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory