Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate WP_073038470.1 BUB04_RS08005 3-deoxy-8-phosphooctulonate synthase
Query= BRENDA::Q9WYH8 (338 letters) >NCBI__GCF_900129305.1:WP_073038470.1 Length = 284 Score = 105 bits (262), Expect = 1e-27 Identities = 78/250 (31%), Positives = 124/250 (49%), Gaps = 21/250 (8%) Query: 83 IDLGDVKIGNGYFTIIAGPCSVEGREMLMETAHFLSE----LGVKVLRGGAYKP--RTSP 136 I +G G F +IAGPC +E E+ A + + LG+ + +Y RTS Sbjct: 11 ITIGGRPFGKDRFFVIAGPCVLESEELAFSVARTMRDVCRDLGIPYIFKSSYDKANRTSI 70 Query: 137 YSFQGLGEK-GLEYLREAADKYGMYVVTEALGEDDLPKVAEYADIIQIGARNAQNFRLLS 195 SF+G G K GLE L + V+T+ +++ VA D++Q A A+ LL Sbjct: 71 QSFRGPGLKAGLEVLGRIKADLDVPVLTDVHSVEEVGPVAAVVDVLQTPAFLARQTDLLV 130 Query: 196 KAGSYNKPVLLKRGFMNTIEEFLLSAEYIANSGNTKIILCERGIRTFEKATRNTLDISAV 255 KPV +K+ + ++GNT+I++ ERG + +D+ +V Sbjct: 131 ACARTGKPVNIKKAQFLAPWDMQQVVAKAESAGNTRILVTERG--SCFGYNNLVVDMRSV 188 Query: 256 PIIRKESHLPILVDPSHS-----------GGRRDLVIPLSRAAIAVGAHGIIVEVHPEPE 304 ++ + + P++ D +HS GG+RD V PL+RAA+A GA G+ +EVH +P+ Sbjct: 189 ALLSRGPY-PVVFDATHSVQLPGGQGISSGGQRDFVEPLARAAVAAGADGVFMEVHEDPD 247 Query: 305 KALSDGKQSL 314 +AL DG SL Sbjct: 248 QALCDGPNSL 257 Lambda K H 0.318 0.138 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 284 Length adjustment: 27 Effective length of query: 311 Effective length of database: 257 Effective search space: 79927 Effective search space used: 79927 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory