Align acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17] (characterized)
to candidate WP_073039302.1 BUB04_RS11050 acetylornithine transaminase
Query= reanno::azobra:AZOBR_RS19025 (389 letters) >NCBI__GCF_900129305.1:WP_073039302.1 Length = 397 Score = 339 bits (869), Expect = 9e-98 Identities = 181/384 (47%), Positives = 234/384 (60%) Query: 4 VVMPTYARADIVFERGEGPYLYATDGRRFLDFAAGVAVNVLGHANPYLVEALTAQAHKLW 63 VV TYAR + FERG G L+ T+G+ ++DF AG+AV LGH++P + + QA KL Sbjct: 11 VVCNTYARYPVAFERGAGCRLWDTEGKEYMDFLAGIAVCNLGHSHPEVARVVCEQARKLV 70 Query: 64 HTSNLFRVAGQESLAKRLTEATFADTVFFTNSGAEAWECGAKLIRKYHYEKGDKARTRII 123 H SNLF Q LA RL E +FAD VFF NSGAEA E KL RKY +K R II Sbjct: 71 HVSNLFYTRPQVELAARLIERSFADKVFFANSGAEANEAAIKLARKYSRDKYGPGRFHII 130 Query: 124 TFEQAFHGRTLAAVSAAQQEKLIKGFGPLLDGFDLVPFGDLEAVRNAVTDETAGICLEPI 183 T + +FHGRTLA +SA QEK+ KGF PL++GF VP+ ++AV AVT++T + +EPI Sbjct: 131 TMKDSFHGRTLATLSATGQEKVHKGFDPLVEGFRFVPYNSIQAVEEAVTEKTCAVLVEPI 190 Query: 184 QGEGGIRAGSVEFLRGLREICDEHGLLLFLDEIQCGMGRTGKLFAHEWAGITPDVMAVAK 243 QGEGG+R G ++ R LRE+C LLL DE+Q GMGRTG LFA+E G+TPDVM +AK Sbjct: 191 QGEGGVRPGDPDYFRALRELCTAKDLLLIFDEVQTGMGRTGSLFAYEQLGVTPDVMTLAK 250 Query: 244 GIGGGFPLGACLATEKAASGMTAGTHGSTYGGNPLATAVGNAVLDKVLEPGFLDHVQRIG 303 +G G P+GA LATE+AA T G+H ST+GG PL TA VL+ + + FL V+ G Sbjct: 251 ALGNGLPIGAMLATEEAARAFTPGSHASTFGGTPLVTAASAKVLEIISKEDFLADVREKG 310 Query: 304 GLLQDRLAGLVAENPAVFKGVRGKGLMLGLACGPAVGDVVVALRANGLLSVPAGDNVVRL 363 RL L ++P RG+GLMLGL VV G + D V+R Sbjct: 311 RYFLGRLQDLQKKHPDKILDARGRGLMLGLELSRPGKTVVDRCLEQGFVINCTHDTVLRF 370 Query: 364 LPPLNIGEAEVEEAVAILAKTAKE 387 +PPL + E++ + L KE Sbjct: 371 VPPLIVTREEIDRLMETLDAVLKE 394 Lambda K H 0.321 0.139 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 397 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 397 Length adjustment: 31 Effective length of query: 358 Effective length of database: 366 Effective search space: 131028 Effective search space used: 131028 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory