Align [amino group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase (EC 2.6.1.118) (characterized)
to candidate WP_073039302.1 BUB04_RS11050 acetylornithine transaminase
Query= BRENDA::Q93R93 (395 letters) >NCBI__GCF_900129305.1:WP_073039302.1 Length = 397 Score = 296 bits (757), Expect = 9e-85 Identities = 160/392 (40%), Positives = 230/392 (58%), Gaps = 12/392 (3%) Query: 12 LLEAEKTLDSGVYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVK 71 L+E + + Y ++ + RG G R+WD EG EY+D + G V NLGH +PEV V Sbjct: 4 LMEVCEKVVCNTYARYPVAFERGAGCRLWDTEGKEYMDFLAGIAVCNLGHSHPEVARVVC 63 Query: 72 RQAETLMAMPQTLPTPMRGEFYRTLTAILPPELNRVFPVNSGTEANEAALKFARAHT--- 128 QA L+ + T + E L I ++VF NSG EANEAA+K AR ++ Sbjct: 64 EQARKLVHVSNLFYTRPQVELAARL--IERSFADKVFFANSGAEANEAAIKLARKYSRDK 121 Query: 129 ---GRKKFVAAMRGFSGRTMGSLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAVDEE 185 GR + F GRT+ +LS T + K + F PLVE F+PYN ++A++ AV E+ Sbjct: 122 YGPGRFHIITMKDSFHGRTLATLSATGQEKVHKGFDPLVEGFRFVPYNSIQAVEEAVTEK 181 Query: 186 TAAVILEPVQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGI 245 T AV++EP+QGEGGVRP P++ RA RE+ K LLI DE+QTGMGRTG FA+E G+ Sbjct: 182 TCAVLVEPIQGEGGVRPGDPDYFRALRELCTAKDLLLIFDEVQTGMGRTGSLFAYEQLGV 241 Query: 246 VPDILTLAKALGGGVPLGVAVMREEVARSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTR 305 PD++TLAKALG G+P+G + EE AR+ G H +TFGG PL AA + + + Sbjct: 242 TPDVMTLAKALGNGLPIGAMLATEEAARAFTPGSHASTFGGTPLVTAASAKVLEIISKED 301 Query: 306 LWERAAELGPWFMEKLRAIPS---PKIREVRGMGLMVGLELKEKAAPYIARLEKEHRVLA 362 E G +F+ +L+ + KI + RG GLM+GLEL + R ++ V+ Sbjct: 302 FLADVREKGRYFLGRLQDLQKKHPDKILDARGRGLMLGLELSRPGKTVVDRCLEQGFVIN 361 Query: 363 LQAGPTVIRFLPPLVIEKEDLERVVEAVRAVL 394 TV+RF+PPL++ +E+++R++E + AVL Sbjct: 362 C-THDTVLRFVPPLIVTREEIDRLMETLDAVL 392 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 397 Length adjustment: 31 Effective length of query: 364 Effective length of database: 366 Effective search space: 133224 Effective search space used: 133224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory