Align Putative [LysW]-aminoadipate/[LysW]-glutamate kinase; EC 2.7.2.17; EC 2.7.2.19 (uncharacterized)
to candidate WP_073039490.1 BUB04_RS11045 acetylglutamate kinase
Query= curated2:A9A1K7 (267 letters) >NCBI__GCF_900129305.1:WP_073039490.1 Length = 303 Score = 125 bits (315), Expect = 8e-34 Identities = 77/253 (30%), Positives = 140/253 (55%), Gaps = 13/253 (5%) Query: 2 ITIKIGGSVVDD--LHPSTIADIKKIAESEGV--ILVHGGGKEVTKVCEQLGKEPKFVTS 57 I IK GG + D L S D+ + + G+ ++VHGGG ++ ++ E++GK+ F Sbjct: 23 IVIKYGGHAMKDEALKESFAKDVV-LMKYIGIHPVVVHGGGPQIGRMLERVGKKSDFRAG 81 Query: 58 PSGIKSRYTDKETAEIFTMVMSGRINKTIVQMLQKNGINAIGLSGVDAKVIEADRKKKLL 117 R TD++T ++ MV++G++NK IV ++ ++G AIGLSG D ++IEA + Sbjct: 82 -----MRVTDEDTMDVVEMVLAGKVNKEIVALINRHGGRAIGLSGKDGQLIEARKMHLYR 136 Query: 118 IVNEKGRKQAIDGGYTGKIREVNASFIKSLLDQGLTPVISPIAISEESEFLNVDGDRAAA 177 + + ID G G++R +N +K L + PVI+P+ + + E N++ D A Sbjct: 137 YQGDDQPPEIIDIGLVGEVRRINVEILKVLEQSRVIPVIAPVGVGPDGETYNINADLVAG 196 Query: 178 YVAGKVGSDKVLFITNVDGLLMD-DKVVPKLTLAEAKEIR--PKIGPGMEKKILASTEAL 234 VA + ++K+L +T+V G+L +++ +T+AEA ++ + GM K+ + +A+ Sbjct: 197 SVASALNAEKLLLMTDVPGVLDGAGQLISSMTVAEAADLMQDETLKGGMIPKVQCAIDAV 256 Query: 235 DMGVTTALIANGQ 247 GV I +G+ Sbjct: 257 QAGVRKVAIVDGR 269 Lambda K H 0.313 0.133 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 303 Length adjustment: 26 Effective length of query: 241 Effective length of database: 277 Effective search space: 66757 Effective search space used: 66757 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory