Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate WP_074200680.1 BUQ81_RS01815 2-hydroxyacid dehydrogenase
Query= BRENDA::P9WNX3 (528 letters) >NCBI__GCF_900141795.1:WP_074200680.1 Length = 326 Score = 155 bits (393), Expect = 2e-42 Identities = 105/284 (36%), Positives = 151/284 (53%), Gaps = 27/284 (9%) Query: 31 GPDRDKLLAAVPEADALLVRSATTVDAEVLAAAPK--LKIVARAGVGLDNVDVDAATARG 88 GPD +A P ADA+ + + DA+VL + ++++ G D+VD+ A G Sbjct: 34 GPDT---VAQCPAADAVSLFVSDWADAQVLEKLVEKGVRMLMLRSAGFDHVDLAVARRLG 90 Query: 89 VLVVNAPTSNIHSAAEHALALLLAASRQIPAADASLREHTWKRSSFSGTEIFGKTVGVVG 148 + V P + H+ A+H LALLL R+I A +R + G ++ GK V+G Sbjct: 91 MRVGRVPAYSPHAVADHTLALLLTLVRRIHLAQDKVRRADFCLQGLMGFDLNGKRAAVIG 150 Query: 149 LGRIGQLVAQRIAAFGAYVVAYDPYVSPARAAQLGIELLSLDDLLARADFISVHLPKTPE 208 LGRIG+LVAQR+ AFG VV +DPY A +G+ +SL++ L +D +S++ P TPE Sbjct: 151 LGRIGRLVAQRLQAFGCEVVGHDPY-----AQVVGVPDVSLEEALEVSDIVSLNCPLTPE 205 Query: 209 TAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFATE------- 261 T L++ E L K KPG ++VN RG L+D AAL DA+ H+ A LDV+ E Sbjct: 206 TRHLLNAERLQKMKPGAVVVNTGRGALIDTAALLDALRSDHLGGAALDVYEFERGLFFED 265 Query: 262 --------PCTDSPLFELAQVVVTPHLGASTAEA-QDRAGTDVA 296 P + L L VV+T H T EA ++ A T VA Sbjct: 266 HRDEGIRDPML-AQLMALPNVVITGHQAFLTQEAVENIARTTVA 308 Lambda K H 0.317 0.133 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 528 Length of database: 326 Length adjustment: 31 Effective length of query: 497 Effective length of database: 295 Effective search space: 146615 Effective search space used: 146615 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory