Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate WP_074201260.1 BUQ81_RS04885 threonine synthase
Query= BRENDA::O66740 (352 letters) >NCBI__GCF_900141795.1:WP_074201260.1 Length = 359 Score = 412 bits (1060), Expect = e-120 Identities = 199/350 (56%), Positives = 268/350 (76%), Gaps = 2/350 (0%) Query: 3 RWQGIIKQYKKYLPVDENTPIVTLYEGNTPLIEADNLARAIGFKGKIYLKYEGLNPTGSF 62 R+ G+I++Y+ LPV ++T I++L EGNTPLI +++ R +G IY+KYEGLNPTGSF Sbjct: 6 RYTGLIEKYRDRLPVHDDTRIISLGEGNTPLIRLNHIPRQLGKDVDIYVKYEGLNPTGSF 65 Query: 63 KDRGMTLAISKAVEAGKRAVICASTGNTSASAAAYAARAGLRAYVLLPKGAVAIGKLSQA 122 KDRGMT+A++KAV+ G +A+ICASTGNTSA+AAAYAARAG+RA+VL+P G +A+GKL+QA Sbjct: 66 KDRGMTMAVTKAVDEGAKAIICASTGNTSAAAAAYAARAGIRAFVLIPDGKIAMGKLAQA 125 Query: 123 MIYGAKVLAIQGTFDDALNIVRKIGENFPVEIVNSVNPYRIEGQKTAAFEICDTLGEAPD 182 +++GA V+ I+G FDD + +V+++ ++ PV IVNS+NP R++GQKTAAFEI + LG APD Sbjct: 126 LMHGAVVIQIKGNFDDGMRLVKEVADHAPVTIVNSINPNRLQGQKTAAFEIIEELGRAPD 185 Query: 183 YHFIPVGNAGNITAYWKGFKIYYEEGKITKLPRMMGWQAEGAAPIVKGYPIKNPQTIATA 242 YH +PVGNAGNITA+W G+ YY +G + PRM+G+QA G+AP VKG + NP+T+ATA Sbjct: 186 YHCLPVGNAGNITAHWMGYDEYYRDGIVGTRPRMVGYQASGSAPFVKGEMVDNPETVATA 245 Query: 243 IKIGNPYSWKSALKAAQESGGKIDAVSDSEILYAYKLIASTEGVFCEPASAASVAGLIKL 302 I+IG+P SW+ A +ES G DA SD EIL A KL+A EGVFCEPASA SVAG ++ Sbjct: 246 IRIGHPQSWELAWNLQKESNGWFDACSDEEILAAQKLLAQAEGVFCEPASATSVAGAMRD 305 Query: 303 VREGFFKGGEVVTCTLTGNGLKDPDTAIKVCEEP--ITVPPDFDEVVKVL 350 ++ G G V CTLTG+GLKDPDTAI + +TV + DEV + + Sbjct: 306 IQNGKIPEGSTVVCTLTGHGLKDPDTAIAQSADTKVVTVAAEMDEVRRAI 355 Lambda K H 0.317 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 359 Length adjustment: 29 Effective length of query: 323 Effective length of database: 330 Effective search space: 106590 Effective search space used: 106590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_074201260.1 BUQ81_RS04885 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.14778.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-100 320.7 0.0 7e-100 320.4 0.0 1.1 1 lcl|NCBI__GCF_900141795.1:WP_074201260.1 BUQ81_RS04885 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900141795.1:WP_074201260.1 BUQ81_RS04885 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 320.4 0.0 7e-100 7e-100 1 340 [] 11 330 .. 11 330 .. 0.97 Alignments for each domain: == domain 1 score: 320.4 bits; conditional E-value: 7e-100 TIGR00260 1 vvryreilevt.ekdlvdlaegstelfrspklaeevga.enlyvkelfhgPtlaFKDrglqfvavlltk 67 +++yr l+v ++++++l eg+t+l+r +++++++g+ ++yvk ++++Pt++FKDrg +++++tk lcl|NCBI__GCF_900141795.1:WP_074201260.1 11 IEKYRDRLPVHdDTRIISLGEGNTPLIRLNHIPRQLGKdVDIYVKYEGLNPTGSFKDRG---MTMAVTK 76 689***********************************9********************...******* PP TIGR00260 68 alelgnetvlcAtsGdtgaaaaealagkanvkvvvLyPkgkispvkeklvtalaenakvlaikGdFDda 136 a ++g+++++cA++G+t+aaaa a+a++a+++++vL+P+gki+ +kl++al+++a v++ikG+FDd lcl|NCBI__GCF_900141795.1:WP_074201260.1 77 AVDEGAKAIICASTGNTSAAAA-AYAARAGIRAFVLIPDGKIA--MGKLAQALMHGAVVIQIKGNFDDG 142 **********************.********************..************************ PP TIGR00260 137 qdlvkeifedkeklklnsvNsinparieaqktyafeiveqlgkespdkvvvpvp.sgnfgailkGflek 204 +lvke++++ + + +ns+N p r+++qkt+afei+e+lg ++pd ++pv+ +gn++a ++G+ e+ lcl|NCBI__GCF_900141795.1:WP_074201260.1 143 MRLVKEVADHAPVTIVNSIN---PNRLQGQKTAAFEIIEELG-RAPDYHCLPVGnAGNITAHWMGYDEY 207 ********998877777777...*******************.9************************* PP TIGR00260 205 kelg....lpieklaiaaegaadivrrflksgdlepkedkeTlstAmdignpsnveralelarrslgnl 269 + g +p ++ + +a g+a++v+ ++eT++tA++ig+p ++e a++l ++s+g + lcl|NCBI__GCF_900141795.1:WP_074201260.1 208 YRDGivgtRP-RMVGYQASGSAPFVKGE-------MVDNPETVATAIRIGHPQSWELAWNLQKESNGWF 268 ***9999999.**********9999877.......67889***************************** PP TIGR00260 270 edlkesvsdeeileaikklaeeegyllephtavavaalkklvekgvsatadpaKFeevvealtgnklkd 338 ++ sdeeil a+k+la+ eg+++ep++a++va+ + +++g +++++ ++vv+ ltg++lkd lcl|NCBI__GCF_900141795.1:WP_074201260.1 269 DAC----SDEEILAAQKLLAQAEGVFCEPASATSVAGAMRDIQNG---KIPEG--STVVCTLTGHGLKD 328 *99....**************************************...*****..************** PP TIGR00260 339 pe 340 p+ lcl|NCBI__GCF_900141795.1:WP_074201260.1 329 PD 330 97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (359 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.89 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory