Align Serine O-succinyltransferase; SST; Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.-; EC 2.3.1.46 (characterized)
to candidate WP_074201658.1 BUQ81_RS06945 homoserine O-acetyltransferase
Query= SwissProt::S2KHP1 (367 letters) >NCBI__GCF_900141795.1:WP_074201658.1 Length = 378 Score = 244 bits (624), Expect = 2e-69 Identities = 141/355 (39%), Positives = 197/355 (55%), Gaps = 8/355 (2%) Query: 13 PVRMYRGGELPSVTIAYETWGELRGQGDNALLLFTGLSPSAHAASSM-ADPSPGWWEYMI 71 P+ G +P+ + YET+G+L NA+L+ LS + H A D PGWWE+ + Sbjct: 19 PLHTVSGSVIPAYDLVYETYGQLNADKSNAILICHALSGNHHVAGYYDGDEKPGWWEHYV 78 Query: 72 GPGKPIDTERFFVIAINSLGSCFGSTGPASINPATGQPYRLDFPKLSVEDIVAAARGACR 131 GPGKPIDT RFFV+ +N+LG C GSTGPASINP TG+P+ DFP ++V+D V + Sbjct: 79 GPGKPIDTNRFFVVGVNNLGGCHGSTGPASINPETGRPWGPDFPIITVKDWVVSQDKLRE 138 Query: 132 ALGIDHVHTVAGASLGGMDALAYAVMYPGTYRDIISISAAAHATPFTIALRSIQREAVRA 191 LGI+ V G SLGGM + +A+ P R + I+AA + IA + R A+ + Sbjct: 139 HLGIEQWAAVVGGSLGGMQVIQWAIDRPDRLRHAVVIAAAPRLSAQNIAFNEVARTAIMS 198 Query: 192 DPAWAGGNYAP-GEGPKDGMRVARQLGILTYRSAEEWLQRFDRERLEGSDDSANPFAMAF 250 DP + GG Y G PK G+ +AR LG LTY S + ++F RE D F + F Sbjct: 199 DPDFHGGRYLEHGVIPKRGLALARMLGHLTYLSDDLMGKKFGREL---RDRLKYNFDVEF 255 Query: 251 QVQSYMEANARKFADR--FDANCYLYLSQAMDLFDMAEHGDGSLEAAVRRIDAKRALVAG 308 QV+SY+ KFA R FDAN YL +++A+D FD A D L A R+ A LV Sbjct: 256 QVESYLRYQGEKFATRSKFDANTYLLMTKALDYFDPAAEYDHDLSKAFARVQA-GFLVVS 314 Query: 309 VTTDWLFPLWQQRQVAELLEHAGVAVSYHELGSIQGHDAFLVDSERFAPMVAEFL 363 T+DW F + ++ L VSY E+ S GHDAFL+ + + + + ++ Sbjct: 315 FTSDWRFSPERSEEIVRALLDNDKNVSYAEIESQHGHDAFLLPNPFYEGVFSAYM 369 Lambda K H 0.320 0.135 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 378 Length adjustment: 30 Effective length of query: 337 Effective length of database: 348 Effective search space: 117276 Effective search space used: 117276 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory