Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate WP_074201658.1 BUQ81_RS06945 homoserine O-acetyltransferase
Query= SwissProt::Q9AAS1 (382 letters) >NCBI__GCF_900141795.1:WP_074201658.1 Length = 378 Score = 395 bits (1014), Expect = e-114 Identities = 199/366 (54%), Positives = 255/366 (69%), Gaps = 4/366 (1%) Query: 17 FPANEPLRLDSGGVIEGLEIAYQTYGQLNADKSNAVLICHALTGDQHVASPHPTTGKPGW 76 F +EPL SG VI ++ Y+TYGQLNADKSNA+LICHAL+G+ HVA + KPGW Sbjct: 14 FHVDEPLHTVSGSVIPAYDLVYETYGQLNADKSNAILICHALSGNHHVAGYYDGDEKPGW 73 Query: 77 WQRLVGPGKPLDPARHFIICSNVIGGCMGSTGPASINPATGKTYGLSFPVITIADMVRAQ 136 W+ VGPGKP+D R F++ N +GGC GSTGPASINP TG+ +G FP+IT+ D V +Q Sbjct: 74 WEHYVGPGKPIDTNRFFVVGVNNLGGCHGSTGPASINPETGRPWGPDFPIITVKDWVVSQ 133 Query: 137 AMLVSALGVETLFAVVGGSMGGMQVQQWAVDYPERMFSAVVLASASRHSAQNIAFHEVGR 196 L LG+E AVVGGS+GGMQV QWA+D P+R+ AVV+A+A R SAQNIAF+EV R Sbjct: 134 DKLREHLGIEQWAAVVGGSLGGMQVIQWAIDRPDRLRHAVVIAAAPRLSAQNIAFNEVAR 193 Query: 197 QAIMADPDWRGGAYAEHGVRPEKGLAVARMAAHITYLSEPALQRKFGRELQRDGLSWGFD 256 AIM+DPD+ GG Y EHGV P++GLA+ARM H+TYLS+ + +KFGREL RD L + FD Sbjct: 194 TAIMSDPDFHGGRYLEHGVIPKRGLALARMLGHLTYLSDDLMGKKFGREL-RDRLKYNFD 252 Query: 257 ADFQVESYLRHQGSSFVDR--FDANSYLYITRAMDYFDIAASHGGVLAKAFTRARNVRFC 314 +FQVESYLR+QG F R FDAN+YL +T+A+DYFD AA + L+KAF R + F Sbjct: 253 VEFQVESYLRYQGEKFATRSKFDANTYLLMTKALDYFDPAAEYDHDLSKAFARVQ-AGFL 311 Query: 315 VLSFSSDWLYPTAENRHLVRALTAAGARAAFAEIESDKGHDAFLLDEPVMDAALEGFLAS 374 V+SF+SDW + + +VRAL ++AEIES GHDAFLL P + ++ Sbjct: 312 VVSFTSDWRFSPERSEEIVRALLDNDKNVSYAEIESQHGHDAFLLPNPFYEGVFSAYMDR 371 Query: 375 AERDRG 380 R+ G Sbjct: 372 VAREVG 377 Lambda K H 0.321 0.135 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 446 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 378 Length adjustment: 30 Effective length of query: 352 Effective length of database: 348 Effective search space: 122496 Effective search space used: 122496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate WP_074201658.1 BUQ81_RS06945 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.16198.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-143 464.1 0.0 1.6e-143 464.0 0.0 1.0 1 lcl|NCBI__GCF_900141795.1:WP_074201658.1 BUQ81_RS06945 homoserine O-acety Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900141795.1:WP_074201658.1 BUQ81_RS06945 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 464.0 0.0 1.6e-143 1.6e-143 3 345 .. 18 364 .. 16 370 .. 0.97 Alignments for each domain: == domain 1 score: 464.0 bits; conditional E-value: 1.6e-143 TIGR01392 3 eeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk.GWWdellGpgraldt 70 e+l++ sG+v++ ++++y+tyG+lna+++Na+l+cHal+g++hvag++d ++k GWW++++Gpg+++dt lcl|NCBI__GCF_900141795.1:WP_074201658.1 18 EPLHTVSGSVIPAYDLVYETYGQLNADKSNAILICHALSGNHHVAGYYDGDEKpGWWEHYVGPGKPIDT 86 789999*******************************************98888*************** PP TIGR01392 71 sryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlGG 139 +r+fvv++N+lG+c+GstgP+sinpetg+p+g++fP +t++D+v q +l ++Lg+e++aavvGgSlGG lcl|NCBI__GCF_900141795.1:WP_074201658.1 87 NRFFVVGVNNLGGCHGSTGPASINPETGRPWGPDFPIITVKDWVVSQDKLREHLGIEQWAAVVGGSLGG 155 ********************************************************************* PP TIGR01392 140 mqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee.qPekGLalARml 207 mq+++wa++ p+r++++vv+a+++r+saq+iafnev+r ai+sDp++++G+y e++ P++GLalARml lcl|NCBI__GCF_900141795.1:WP_074201658.1 156 MQVIQWAIDRPDRLRHAVVIAAAPRLSAQNIAFNEVARTAIMSDPDFHGGRYLEHGvIPKRGLALARML 224 ********************************************************9************ PP TIGR01392 208 alltYrseesleerfgreakseeslassleeefsvesylryqgkkfver..FdAnsYllltkaldthdl 274 ++ltY+s++ + ++fgre +++ l+++++ ef+vesylryqg+kf++r FdAn+Yll+tkald++d lcl|NCBI__GCF_900141795.1:WP_074201658.1 225 GHLTYLSDDLMGKKFGRELRDR--LKYNFDVEFQVESYLRYQGEKFATRskFDANTYLLMTKALDYFDP 291 ******************9999..67888*****************97555****************** PP TIGR01392 275 argrrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFllekek 341 a++++++l++a+++++a +lvv+++sD++f++e++ee+++al +++++ yaeies++GHDaFll + lcl|NCBI__GCF_900141795.1:WP_074201658.1 292 AAEYDHDLSKAFARVQAGFLVVSFTSDWRFSPERSEEIVRALLDNDKNvsYAEIESQHGHDAFLLPNPF 360 ******************************************99999889**************98877 PP TIGR01392 342 veel 345 +e + lcl|NCBI__GCF_900141795.1:WP_074201658.1 361 YEGV 364 6655 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (378 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.54 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory