Align ornithine aminotransferase (EC 2.6.1.13) (characterized)
to candidate WP_075385764.1 BK574_RS22825 glutamate-1-semialdehyde-2,1-aminomutase
Query= BRENDA::A0A3B6KM96 (472 letters) >NCBI__GCF_002019605.1:WP_075385764.1 Length = 428 Score = 135 bits (340), Expect = 3e-36 Identities = 101/320 (31%), Positives = 156/320 (48%), Gaps = 22/320 (6%) Query: 58 PMVFSKGEGSHILDPEGNKYIDFLSAYSAVNQGHCHPKVLRALIEQAERLTLSSRAFYND 117 P+ +GEG+ I D +GN++ID++ ++ + GH +V+ AL + E+ T S A Sbjct: 36 PVFMERGEGARIYDIDGNEFIDYVLSWGPLILGHADDQVVEALKKSVEKGT-SFGAPSEL 94 Query: 118 KFPVFAQYLTSMFGYDMMLPMNTGAEGVETAIKLARKWGYEKKNIPKNEALIVSCCGCFH 177 + + + + +++ +N+G E +A++LAR GY +N IV GC+H Sbjct: 95 ETQLAKLVIERVPSIEVVRMVNSGTEATMSALRLAR--GYTGRN------KIVKFEGCYH 146 Query: 178 GRTLGVISMSCDNDATRGF--GPLVP-----GHLKVDFGDIDGLEKIFKEHGDRICGFLF 230 G ++ + AT G P VP L V + D++ L+ F + GD I G + Sbjct: 147 GHGDSLLIKAGSGVATLGLPDSPGVPESIAQNTLTVPYNDLESLQLAFDKFGDDIAGVIL 206 Query: 231 EPIQGEAGVIIPPDGYLKAVRDLCSRHNILMIDDEIQTGIARTGKMLACDWEGVRPDMVI 290 EP+ G GV+ P G+L+AVR++ H L+I DE+ TG R G A G+ PD+ Sbjct: 207 EPVAGNMGVVRPEPGFLEAVREMTHAHGSLLIFDEVMTGF-RVGYHCAQGEFGITPDLTC 265 Query: 291 LGKALGAGVVPVSAVLADKDIMLCIKPG---EHGSTFGGNPLASAVAIASLKVVKDEGLV 347 LGK +G G +PV A ++IM I P T GNPLA +L +K E Sbjct: 266 LGKVIGGG-LPVGAYGGRREIMEQIAPAGPIYQAGTLSGNPLAMTAGYETLSQLKPEH-Y 323 Query: 348 ERAAELGQEFRDQLRKVQQK 367 E LG+ D L K Sbjct: 324 EEFNRLGKRLADGLSAAATK 343 Lambda K H 0.321 0.138 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 442 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 472 Length of database: 428 Length adjustment: 33 Effective length of query: 439 Effective length of database: 395 Effective search space: 173405 Effective search space used: 173405 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory