Align cysteine synthase (EC 2.5.1.47) (characterized)
to candidate WP_075385937.1 BK574_RS21905 cysteine synthase A
Query= BRENDA::P37887 (308 letters) >NCBI__GCF_002019605.1:WP_075385937.1 Length = 312 Score = 348 bits (893), Expect = e-101 Identities = 187/310 (60%), Positives = 224/310 (72%), Gaps = 3/310 (0%) Query: 2 VRVANSITELIGNTPIVKLNRLADENSADVYLKLEYMNPGSSVKDRIGLAMIEAAEKEGK 61 +RV N+I ELIG+TP+VKLN++AD+N A VYLKLE+ NP SVKDR MI AEK+G Sbjct: 1 MRVVNNIAELIGHTPLVKLNKIADKNGASVYLKLEFFNPSGSVKDRAAYQMIIQAEKDGL 60 Query: 62 LKAGNTIIEPTSGNTGIGLAMVAAAKGLKAILVMPDTMSMERRNLLRAYGAELVLTPGAE 121 LK G TIIEPTSGNTGIGLAM AAA+G KAIL MPDTMS ER N+L+AYGAE+VLT G + Sbjct: 61 LKPGATIIEPTSGNTGIGLAMNAAARGYKAILTMPDTMSEERINILKAYGAEVVLTEGDK 120 Query: 122 GMKGAIKKAEELAEK-HGYFVPQQFNNPSNPEIHRQTTGKEIVEQFGD--DQLDAFVAGI 178 M GAI KA ELA+ FVP QF NP+NP+ HR TT EI E +L AFVA Sbjct: 121 KMPGAIDKAHELAKDIPNSFVPMQFENPANPDAHRYTTAVEIKEALDSIGKKLSAFVAAS 180 Query: 179 GTGGTITGAGEVLKEAYPSIKIYAVEPSDSPVLSGGKPGPHKIQGIGAGFVPDILNTEVY 238 GTGGTITG GE LK+ YP ++ VEP+ SPVLSGGKPGPHK+ G GF+P ILN VY Sbjct: 181 GTGGTITGTGEELKKFYPKATVHVVEPAGSPVLSGGKPGPHKLVGTSPGFIPPILNENVY 240 Query: 239 DEIFPVKNEEAFEYARRAAREEGILGGISSGAAIYAALQVAKKLGKGKKVLAIIPSNGER 298 +EI +++E+A+ + AR+EGIL G SSGAA +AAL+VAK L V+AI GER Sbjct: 241 NEIKKIEDEDAYWASIELARKEGILVGPSSGAACFAALEVAKTLSPDDVVVAIACDTGER 300 Query: 299 YLSTPLYQFD 308 YLST L+ F+ Sbjct: 301 YLSTDLFDFE 310 Lambda K H 0.313 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 312 Length adjustment: 27 Effective length of query: 281 Effective length of database: 285 Effective search space: 80085 Effective search space used: 80085 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
Align candidate WP_075385937.1 BK574_RS21905 (cysteine synthase A)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.6980.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-136 438.4 0.0 7.5e-136 438.2 0.0 1.0 1 lcl|NCBI__GCF_002019605.1:WP_075385937.1 BK574_RS21905 cysteine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002019605.1:WP_075385937.1 BK574_RS21905 cysteine synthase A # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 438.2 0.0 7.5e-136 7.5e-136 2 298 .] 8 307 .. 7 307 .. 0.98 Alignments for each domain: == domain 1 score: 438.2 bits; conditional E-value: 7.5e-136 TIGR01139 2 seliGntPlvrLn.laeeakaevlvkleslnPsssvkdrialamiedaekegllkkgktiveatsGntG 69 +eliG+tPlv+Ln +a+++ a+v++kle++nPs+svkdr+a++mi +aek+gllk+g ti+e+tsGntG lcl|NCBI__GCF_002019605.1:WP_075385937.1 8 AELIGHTPLVKLNkIADKNGASVYLKLEFFNPSGSVKDRAAYQMIIQAEKDGLLKPGATIIEPTSGNTG 76 799**********9999999************************************************* PP TIGR01139 70 ialamvaaargykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkylllkq 138 i+lam aaargyk+iltmp+tms+er ++lkayGae+vLt+g+++m gai+ka+el+++ pn++ +++q lcl|NCBI__GCF_002019605.1:WP_075385937.1 77 IGLAMNAAARGYKAILTMPDTMSEERINILKAYGAEVVLTEGDKKMPGAIDKAHELAKDIPNSF-VPMQ 144 *************************************************************999.**** PP TIGR01139 139 fenpanpeihrkttapeilkdldgk...ldafvagvGtGGtitGvgevlkekkpdikvvavePaespvl 204 fenpanp++hr tta ei ++ld l afva+ GtGGtitG+ge lk+ p+ +v++vePa spvl lcl|NCBI__GCF_002019605.1:WP_075385937.1 145 FENPANPDAHRYTTAVEIKEALDSIgkkLSAFVAASGTGGTITGTGEELKKFYPKATVHVVEPAGSPVL 213 ******************9987753334***************************************** PP TIGR01139 205 sggkpgphkiqGigagfiPkvLdkevidevikvsdeeaietarrlakeeGilvGissGaavaaalkvak 273 sggkpgphk+ G+++gfiP +L+++v++e+ k++de+a+ + +la++eGilvG ssGaa++aal+vak lcl|NCBI__GCF_002019605.1:WP_075385937.1 214 SGGKPGPHKLVGTSPGFIPPILNENVYNEIKKIEDEDAYWASIELARKEGILVGPSSGAACFAALEVAK 282 ********************************************************************* PP TIGR01139 274 klekdkkivvilpdtgerYlstaLf 298 l++d ++v+i++dtgerYlst+Lf lcl|NCBI__GCF_002019605.1:WP_075385937.1 283 TLSPDDVVVAIACDTGERYLSTDLF 307 ************************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (312 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.14 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory