Align O-succinylhomoserine sulfhydrylase (EC 2.5.1.48) (characterized)
to candidate WP_075386831.1 BK574_RS12860 homocysteine synthase
Query= reanno::HerbieS:HSERO_RS16440 (413 letters) >NCBI__GCF_002019605.1:WP_075386831.1 Length = 428 Score = 232 bits (591), Expect = 2e-65 Identities = 138/429 (32%), Positives = 235/429 (54%), Gaps = 24/429 (5%) Query: 1 MNDKKTYGFTTTILHSDRQKGIEHGSLHKPIHTSVTFGYEDARQLAEVFQGKQPGYRYGR 60 M++ K + T +H ++ S PI+ + ++G+++ A +F + G Y R Sbjct: 1 MSENK-WSLETVAVHGGQEVDPATQSRAVPIYQTTSYGFKNTEHAANLFSLAESGNIYTR 59 Query: 61 QGNPTVAALEDKITKMEDGKSTICFATGMAAIGAIVQGLLREGDHVVSSAFLFGNTNSLW 120 NPT E ++ ++E G + + A+G +AI + + GD +V+S+ L+G T +L+ Sbjct: 60 IMNPTQDVFEKRVAELEGGVAALATASGSSAIHLAILNICENGDEIVASSALYGGTYNLF 119 Query: 121 M-TVGAQGAKVSMVDATDVKNVEAAITANTRLVFVETIANPRTQVADLKRIGELCRERGI 179 + T+ G V +VD TD + E AIT T+L+F E I NP+ + D++ + + G+ Sbjct: 120 VHTLKKMGITVHLVDGTDPQAFEQAITPKTKLLFGEMIGNPQGDILDVEAVAAVAHRNGV 179 Query: 180 LYVVDNTMTSPYLFRPKTVGAGLVVNSLTKSIGGHGNALGGALTDTGEFDWT--RYPHIA 237 +VD T+ +P L RP GA +VV+S TK +GGHG ++GG + D G FDW ++P + Sbjct: 180 PLMVDATLVTPALCRPIEHGADIVVHSATKFMGGHGTSIGGVIVDGGNFDWNNGKFPGLT 239 Query: 238 ENYKKNPAPQWG-------------MAQIRAKALRDFGGSLGPEAAHHIAVGAETIALRQ 284 E P P + + + R + LRD G ++ P + + G ET+ LR Sbjct: 240 E-----PDPSYHGLVYTEALGNLAYIIKARVQLLRDLGPAIAPLNSFLLLQGLETLHLRM 294 Query: 285 ERECKNALALAQMLQADERVAAVYYPGLESHPQHAL-SKALFRSFGSLMSFELKDGI-DC 342 ER C+NA+ +AQ L+ E V V + GL SH + L +K L G++++F +K GI + Sbjct: 295 ERHCENAMKVAQYLENHELVEWVSFAGLPSHRSYDLANKYLPNGKGAILTFGIKGGIEEG 354 Query: 343 FDYLNRLRLAIPTSNLGDTRTLVIPVAHTIFYEMGAERRASMGIAESLIRVSVGLEDTDD 402 ++N L L +N+GD ++LVI A T ++ + + G++ LIR+SVG+E+ +D Sbjct: 355 KSFINALELFSHVANVGDAKSLVIHPASTTHQQLSEADQRAAGVSPELIRLSVGIENVND 414 Query: 403 LVADFRQAL 411 +++D QAL Sbjct: 415 IISDLEQAL 423 Lambda K H 0.319 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 450 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 413 Length of database: 428 Length adjustment: 32 Effective length of query: 381 Effective length of database: 396 Effective search space: 150876 Effective search space used: 150876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory