Align cysteine synthase (EC 2.5.1.47) (characterized)
to candidate WP_075388449.1 BK574_RS17800 cysteine synthase A
Query= BRENDA::P37887 (308 letters) >NCBI__GCF_002019605.1:WP_075388449.1 Length = 307 Score = 484 bits (1247), Expect = e-142 Identities = 240/307 (78%), Positives = 277/307 (90%), Gaps = 1/307 (0%) Query: 2 VRVANSITELIGNTPIVKLNRLADENSADVYLKLEYMNPGSSVKDRIGLAMIEAAEKEGK 61 +RVANSIT+LIG TP+VKLNR+ E +AD+YLKLEY NPGSSVKDRI LAMIEAAEK+G+ Sbjct: 1 MRVANSITDLIGQTPLVKLNRIVPEGAADIYLKLEYFNPGSSVKDRIALAMIEAAEKDGR 60 Query: 62 LKAGNTIIEPTSGNTGIGLAMVAAAKGLKAILVMPDTMSMERRNLLRAYGAELVLTPGAE 121 LK +TI+EPTSGNTGIGLAMVA+AKG K LVMP+TMS+ERRNLLRAYGAELVLTPG E Sbjct: 61 LKPEDTIVEPTSGNTGIGLAMVASAKGYKTKLVMPETMSIERRNLLRAYGAELVLTPGPE 120 Query: 122 GMKGAIKKAEELAEKHGYFVPQQFNNPSNPEIHRQTTGKEIVEQFGDDQLDAFVAGIGTG 181 GM GAI+KA EL+++ GYF+PQQF N +NPEIHR+TTGKE++EQ D +DAF++GIGTG Sbjct: 121 GMGGAIRKATELSKEDGYFMPQQFENEANPEIHRETTGKELLEQV-DGSVDAFISGIGTG 179 Query: 182 GTITGAGEVLKEAYPSIKIYAVEPSDSPVLSGGKPGPHKIQGIGAGFVPDILNTEVYDEI 241 GTITGAG +LKE +P +KIYAVEP+DSPVLSGGKPGPHKIQGIGAGFVP IL+T+VYDE+ Sbjct: 180 GTITGAGGLLKENFPELKIYAVEPADSPVLSGGKPGPHKIQGIGAGFVPSILDTKVYDEV 239 Query: 242 FPVKNEEAFEYARRAAREEGILGGISSGAAIYAALQVAKKLGKGKKVLAIIPSNGERYLS 301 V N++AFEYARRA REEGILGGISSGAAIYAA+QVA+KLG GKKV+AIIPSNGERYLS Sbjct: 240 IKVTNDQAFEYARRAGREEGILGGISSGAAIYAAIQVAEKLGAGKKVVAIIPSNGERYLS 299 Query: 302 TPLYQFD 308 TPLYQFD Sbjct: 300 TPLYQFD 306 Lambda K H 0.313 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 307 Length adjustment: 27 Effective length of query: 281 Effective length of database: 280 Effective search space: 78680 Effective search space used: 78680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
Align candidate WP_075388449.1 BK574_RS17800 (cysteine synthase A)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.15793.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-146 473.8 0.1 1.2e-146 473.6 0.1 1.0 1 lcl|NCBI__GCF_002019605.1:WP_075388449.1 BK574_RS17800 cysteine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002019605.1:WP_075388449.1 BK574_RS17800 cysteine synthase A # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 473.6 0.1 1.2e-146 1.2e-146 1 298 [] 7 303 .. 7 303 .. 0.99 Alignments for each domain: == domain 1 score: 473.6 bits; conditional E-value: 1.2e-146 TIGR01139 1 iseliGntPlvrLn.laeeakaevlvkleslnPsssvkdrialamiedaekegllkkgktiveatsGnt 68 i++liG+tPlv+Ln ++ e +a++++kle++nP+ssvkdrialamie aek+g lk+++tive+tsGnt lcl|NCBI__GCF_002019605.1:WP_075388449.1 7 ITDLIGQTPLVKLNrIVPEGAADIYLKLEYFNPGSSVKDRIALAMIEAAEKDGRLKPEDTIVEPTSGNT 75 589***********8888899************************************************ PP TIGR01139 69 GialamvaaargykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkylllk 137 Gi+lamva+a+gyk l+mpetms+err+ll+ayGaelvLt+g egm gai+ka el +e++ y++++ lcl|NCBI__GCF_002019605.1:WP_075388449.1 76 GIGLAMVASAKGYKTKLVMPETMSIERRNLLRAYGAELVLTPGPEGMGGAIRKATELSKEDG--YFMPQ 142 *************************************************************9..99*** PP TIGR01139 138 qfenpanpeihrkttapeilkdldgkldafvagvGtGGtitGvgevlkekkpdikvvavePaespvlsg 206 qfen+anpeihr+tt++e+l+++dg++daf++g+GtGGtitG+g +lke++p++k++avePa+spvlsg lcl|NCBI__GCF_002019605.1:WP_075388449.1 143 QFENEANPEIHRETTGKELLEQVDGSVDAFISGIGTGGTITGAGGLLKENFPELKIYAVEPADSPVLSG 211 ********************************************************************* PP TIGR01139 207 gkpgphkiqGigagfiPkvLdkevidevikvsdeeaietarrlakeeGilvGissGaavaaalkvakkl 275 gkpgphkiqGigagf+P++Ld++v+devikv++++a+e+arr +eeGil GissGaa++aa++va+kl lcl|NCBI__GCF_002019605.1:WP_075388449.1 212 GKPGPHKIQGIGAGFVPSILDTKVYDEVIKVTNDQAFEYARRAGREEGILGGISSGAAIYAAIQVAEKL 280 ********************************************************************* PP TIGR01139 276 ekdkkivvilpdtgerYlstaLf 298 +++kk+v+i+p++gerYlst+L+ lcl|NCBI__GCF_002019605.1:WP_075388449.1 281 GAGKKVVAIIPSNGERYLSTPLY 303 *********************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (307 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.62 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory