Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (uncharacterized)
to candidate WP_075858772.1 cpu_RS04100 homoserine kinase
Query= curated2:Q3AAV5 (304 letters) >NCBI__GCF_001950255.1:WP_075858772.1 Length = 304 Score = 543 bits (1398), Expect = e-159 Identities = 274/304 (90%), Positives = 287/304 (94%) Query: 1 MVCVLIPATSANLGPGFDAVGMALSFYNEVSLGPSPKELEIEVFGDGAELISRDKNNLVY 60 MV VLIPATSANLGPGFDAVGMALSFYNEV L PSPKELEI+V+GDG+E+I +D+NNLVY Sbjct: 1 MVRVLIPATSANLGPGFDAVGMALSFYNEVCLKPSPKELEIDVWGDGSEIIPKDRNNLVY 60 Query: 61 VAITKIFERLGKTPRNLKLTLKNRVPLARGLGSSAAAIVGGLVAANAYLGNPLPKDELLR 120 +A+TK+FE LGK PRNLKL+LKNRVP ARGLGSSAAAIVGGLVAANAYLGNPLP DELLR Sbjct: 61 IAVTKVFESLGKIPRNLKLSLKNRVPFARGLGSSAAAIVGGLVAANAYLGNPLPTDELLR 120 Query: 121 LATELEGHPDNVAPALLGGVVVSGFDRDKVKYLKLPVPEVEVVVAIPKFQLKTADSRQIL 180 LATELEGHPDNVAPALLGGVVVSGFDRDKVKYLKLPVPEVEVVVAIPKFQLKT DSRQIL Sbjct: 121 LATELEGHPDNVAPALLGGVVVSGFDRDKVKYLKLPVPEVEVVVAIPKFQLKTVDSRQIL 180 Query: 181 PAEIPFSQAVLNVNRVSFLIAAFCLKKYEYLQIGMEDYLHQPYRSQLIPGFYQVVEEAKK 240 P EIPFSQAVLNVNRVSFLIAAFCLKKYEYLQIGMEDYLHQPYRSQLIPGFYQV+EEAKK Sbjct: 181 PVEIPFSQAVLNVNRVSFLIAAFCLKKYEYLQIGMEDYLHQPYRSQLIPGFYQVMEEAKK 240 Query: 241 AGAYGVALSGSGPTVIALAREGKAVGRAIEETFLNFGVEAEIIYTRPEERGAIDLINYKG 300 AGAYGVALSGSGPTVIA ARE +AVGRAI E FLNF VEAEIIYTRPE RGAIDLI +KG Sbjct: 241 AGAYGVALSGSGPTVIAFARESEAVGRAIREAFLNFNVEAEIIYTRPENRGAIDLIMHKG 300 Query: 301 EGDC 304 EGDC Sbjct: 301 EGDC 304 Lambda K H 0.318 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 420 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 304 Length adjustment: 27 Effective length of query: 277 Effective length of database: 277 Effective search space: 76729 Effective search space used: 76729 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_075858772.1 cpu_RS04100 (homoserine kinase)
to HMM TIGR00191 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00191.hmm # target sequence database: /tmp/gapView.34822.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00191 [M=304] Accession: TIGR00191 Description: thrB: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-90 287.7 0.0 4.7e-90 287.5 0.0 1.0 1 NCBI__GCF_001950255.1:WP_075858772.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_001950255.1:WP_075858772.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 287.5 0.0 4.7e-90 4.7e-90 1 294 [. 2 287 .. 2 294 .. 0.93 Alignments for each domain: == domain 1 score: 287.5 bits; conditional E-value: 4.7e-90 TIGR00191 1 lkvkvPassANlgpGfDvlGlalslvlellvtedvaqeskdksleaegegvekipkesdkNliyqvakkvlkk 73 ++v +Pa+sANlgpGfD +G+als ++e+ +++ + k+ ++ g+g e ipk+ ++Nl+y +++kv+++ NCBI__GCF_001950255.1:WP_075858772.1 2 VRVLIPATSANLGPGFDAVGMALSFYNEVCLKP----SPKELEIDVWGDGSEIIPKD-RNNLVYIAVTKVFES 69 6899*****************************....88888999************.*************** PP TIGR00191 74 lgkrvkpvkltvekeiplgrGLGSSaaaivaaviaanelaglklskeelldlalllEgHpDNvapallGGlql 146 lgk + +kl +++ +p +rGLGSSaaaiv++++aan+ +g++l + ell la++lEgHpDNvapallGG+++ NCBI__GCF_001950255.1:WP_075858772.1 70 LGKIPRNLKLSLKNRVPFARGLGSSAAAIVGGLVAANAYLGNPLPTDELLRLATELEGHPDNVAPALLGGVVV 142 **********************************************************************999 PP TIGR00191 147 avkeddllevlkvPsgsklkvvlviPnievsTaeaRavLPkaysrqdlvfnlshlavlvtAlvskdkadllai 219 + + d+++ lk+P ++++vv++iP+++++T ++R++LP + + +++v n+++++ l++A+ k k ++l+i NCBI__GCF_001950255.1:WP_075858772.1 143 SGFDRDKVKYLKLPV-PEVEVVVAIPKFQLKTVDSRQILPVEIPFSQAVLNVNRVSFLIAAFCLK-KYEYLQI 213 86655559******6.9************************************************.******* PP TIGR00191 220 amkDrvhqpyRekliPelteikqaakekgalgitlSGaGptilalaeeekeekaqelleklakegieltvkvl 292 m+D +hqpyR++liP++ ++ ++ak++ga+g++lSG+Gpt++a+a+e++ + e + + + e+++ NCBI__GCF_001950255.1:WP_075858772.1 214 GMEDYLHQPYRSQLIPGFYQVMEEAKKAGAYGVALSGSGPTVIAFARESE-AVGRAIREAFLNFNVEAEIIYT 285 ************************************************99.4444455555555555555555 PP TIGR00191 293 el 294 ++ NCBI__GCF_001950255.1:WP_075858772.1 286 RP 287 55 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (304 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 14.45 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory