Align N-acetyl-gamma-glutamyl-phosphate reductase; Short=AGPR; EC 1.2.1.38 (characterized, see rationale)
to candidate WP_077277213.1 B1C78_RS00050 N-acetyl-gamma-glutamyl-phosphate reductase
Query= uniprot:E4PLW0 (388 letters) >NCBI__GCF_002000365.1:WP_077277213.1 Length = 343 Score = 448 bits (1153), Expect = e-131 Identities = 219/345 (63%), Positives = 264/345 (76%), Gaps = 2/345 (0%) Query: 44 VIKVGIVGGTGYTGVELLRILAVHPEVSVSCITSRSEAGMPVAEMYPNLRGHYDLAFSEP 103 +I+ G+VG TGYTGVELLR+L HP+ +TSR AG P+A M+PNLRGH DL F+EP Sbjct: 1 MIRAGVVGATGYTGVELLRLLLSHPQAQPVVVTSRGNAGEPLAAMFPNLRGHTDLTFTEP 60 Query: 104 DVNVLGACDLVFFATPHGVAMRMVPELMSAGVRVVDLSADFRLKDLDVWANWYGMAHESP 163 D L CD+VFFATPHGVA + EL+S G RV+DLSADFRL+D ++WA WYG H +P Sbjct: 61 DAGRLADCDVVFFATPHGVAHGLAGELLSRGTRVIDLSADFRLRDPELWARWYGQPHGAP 120 Query: 164 EWAEKAVYGLPEVVRDEIRNAQLVANPGCYPTAVQLGFLPLLEQGLVDPKRLIADAKSGA 223 E + AVYGLPE+ R I A+L+A PGCYPTAV LGF+PLLEQGLVD RL+ADAKSG Sbjct: 121 ELLDAAVYGLPEINRASIPKARLIAVPGCYPTAVILGFIPLLEQGLVDTGRLVADAKSGV 180 Query: 224 SGAGRQGKIGMLHGEIGESFKAYGASGHRHLPEIRQGLCGAAGGDVGVTFVPHLIPMIRG 283 SGAGR+ ++G L E E+FKAYG GHRHLPEI Q L AG G+TFVPHL+PMIRG Sbjct: 181 SGAGRKAQVGTLLCEASETFKAYGVPGHRHLPEILQTLAQVAGAQPGLTFVPHLLPMIRG 240 Query: 284 IEATLYAELKNPADFDRLQALFEQRFDDEPFVDVMPFGSHPETRSVRGANQCRMALHRQE 343 I ATLYA L +P +QAL+E R+ DEPFVDVMP GSHPETRSVRG N+CR+A+HR + Sbjct: 241 IHATLYATLSDPG--TDVQALYETRYRDEPFVDVMPAGSHPETRSVRGTNRCRLAVHRPQ 298 Query: 344 QSNIVIVSSVIDNLVKGAAGQAVQNMNIMFGLKETMGLEAPALLP 388 + V+V SVIDNLVKGA+GQA+QN+N+MFGL ET GL+ A+LP Sbjct: 299 DGDTVVVLSVIDNLVKGASGQAIQNLNLMFGLAETTGLDGIAVLP 343 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 462 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 343 Length adjustment: 30 Effective length of query: 358 Effective length of database: 313 Effective search space: 112054 Effective search space used: 112054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_077277213.1 B1C78_RS00050 (N-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01850.hmm # target sequence database: /tmp/gapView.960.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01850 [M=345] Accession: TIGR01850 Description: argC: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-133 429.4 0.0 5.9e-133 429.3 0.0 1.0 1 lcl|NCBI__GCF_002000365.1:WP_077277213.1 B1C78_RS00050 N-acetyl-gamma-glu Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002000365.1:WP_077277213.1 B1C78_RS00050 N-acetyl-gamma-glutamyl-phosphate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 429.3 0.0 5.9e-133 5.9e-133 1 345 [] 2 343 .] 2 343 .] 0.97 Alignments for each domain: == domain 1 score: 429.3 bits; conditional E-value: 5.9e-133 TIGR01850 1 ikvaivGasGYtGaeLlrllakHpevevtklvssre.agkklsevhphlkglvdlkleeleeeeileea 68 i++++vGa+GYtG+eLlrll +Hp+++ + +v+sr ag++l++++p+l+g++dl+++e ++ + l+++ lcl|NCBI__GCF_002000365.1:WP_077277213.1 2 IRAGVVGATGYTGVELLRLLLSHPQAQPV-VVTSRGnAGEPLAAMFPNLRGHTDLTFTEPDAGR-LADC 68 5899***********************99.6666656*********************998874.67** PP TIGR01850 69 dvvflAlphgvsaelvpellekgvkvidlSadfRlkdaevYekwYgkkhekeelleeavYGlpElnree 137 dvvf+A+phgv++ l+ ell++g++vidlSadfRl+d+e++++wYg++h ++ell+ avYGlpE+nr + lcl|NCBI__GCF_002000365.1:WP_077277213.1 69 DVVFFATPHGVAHGLAGELLSRGTRVIDLSADFRLRDPELWARWYGQPHGAPELLDAAVYGLPEINRAS 137 ********************************************************************* PP TIGR01850 138 ikkaklianPGCyaTaalLalaPllkekliepksiivdaksGvSgAGrkasekslfaevnenlkpYkvt 206 i ka+lia+PGCy+Ta++L+ +Pll+++l+++ +++ daksGvSgAGrka+ +l++e++e +k+Y v lcl|NCBI__GCF_002000365.1:WP_077277213.1 138 IPKARLIAVPGCYPTAVILGFIPLLEQGLVDTGRLVADAKSGVSGAGRKAQVGTLLCEASETFKAYGVP 206 ********************************************************************* PP TIGR01850 207 kHrHtpEieqelsklaekkvkvsftphlvpmtrGilatiyaklkkelteeelrklyeevYedepfvrvl 275 +HrH pEi q+l ++a+++ ++f+phl+pm+rGi+at+ya+l++ +++++lye++Y+depfv+v+ lcl|NCBI__GCF_002000365.1:WP_077277213.1 207 GHRHLPEILQTLAQVAGAQPGLTFVPHLLPMIRGIHATLYATLSD--PGTDVQALYETRYRDEPFVDVM 273 *********************************************..5699****************** PP TIGR01850 276 kegelPstkavlgsnfvdigvavdeetkrvvvvsaiDNLvKGaagqAvqnlNlmlgfdetegLeklpll 344 ++g+ P+t++v+g+n ++++v+ ++ ++vvv+s+iDNLvKGa+gqA+qnlNlm+g++et+gL+ +++l lcl|NCBI__GCF_002000365.1:WP_077277213.1 274 PAGSHPETRSVRGTNRCRLAVHRPQDGDTVVVLSVIDNLVKGASGQAIQNLNLMFGLAETTGLDGIAVL 342 ***************************************************************999887 PP TIGR01850 345 p 345 p lcl|NCBI__GCF_002000365.1:WP_077277213.1 343 P 343 7 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (345 nodes) Target sequences: 1 (343 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.90 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory