Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate WP_077278291.1 B1C78_RS06275 acetylglutamate kinase
Query= BRENDA::Q87EL2 (421 letters) >NCBI__GCF_002000365.1:WP_077278291.1 Length = 295 Score = 128 bits (322), Expect = 2e-34 Identities = 95/290 (32%), Positives = 145/290 (50%), Gaps = 34/290 (11%) Query: 6 EISQYLKRFSQLDAKRFAVVKVGGAVLRDD--VDALTSSLSFLQEVGLTPIVLHGAGPQL 63 E Y++RFS + V+K GG + D+ + L++VGL P+V+HG GPQ+ Sbjct: 15 EALPYIQRFSG----KTIVIKYGGNAMVDENLQRGFARDIVLLKQVGLNPVVVHGGGPQI 70 Query: 64 DEELTAVGIQKKTVNGFRVTLPETMAIVRKVFHA-TNLQLIEALQRNGARATSITG---G 119 + L +G + + V+G RVT ETM +V+ V N Q++ + R G RA +TG G Sbjct: 71 GKVLAQIGKESRFVDGLRVTDSETMDVVQMVLGGLVNKQIVNLINRFGGRAVGLTGKDGG 130 Query: 120 VFEAHYLDQET------------YGLVGGISAVNIAPIEASLRAASIPVIASLGETPSGQ 167 + A L G VG ++ ++ A + IPVIA +G G Sbjct: 131 LIHARRLSHSRASADADAPEIIDLGHVGEVAGIDPAVVHMLDSGDFIPVIAPIGVGDDGT 190 Query: 168 ILNINADVAANELVHVLQPYKIIFLTGTGGLLDADGKIINSINLSTEYEQLIQQPWVYGG 227 NINAD+ A ++ VL K+I LT T G+LD GK++ + + + ++LI+ ++GG Sbjct: 191 AYNINADLVAGKMASVLNAEKLILLTNTPGVLDPQGKLLTGLT-ARQVDELIEDGTIHGG 249 Query: 228 MKLKIEQIKHLLDRLPLESSVSITRPAD------LAKELFTHKGSGTLIR 271 M I +I LD ++S V D + ELFT +G GTLIR Sbjct: 250 M---IPKIACALD--AVKSGVKSAHIIDGRVEHAVLLELFTDEGVGTLIR 294 Lambda K H 0.320 0.136 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 295 Length adjustment: 29 Effective length of query: 392 Effective length of database: 266 Effective search space: 104272 Effective search space used: 104272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory