Align 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC 5.3.1.16; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (uncharacterized)
to candidate WP_077279579.1 B1C78_RS12890 imidazole glycerol phosphate synthase subunit HisF
Query= curated2:Q0W0J3 (240 letters) >NCBI__GCF_002000365.1:WP_077279579.1 Length = 256 Score = 125 bits (313), Expect = 1e-33 Identities = 74/241 (30%), Positives = 133/241 (55%), Gaps = 13/241 (5%) Query: 5 VIPAIDLKGGKCVQLVQGVPGTEMVSIDDAVEVAAGWVGQGAKTLHIIDLDGAFSGSRKN 64 +IP +D+ G+ +V+GV E+ D VE+A + +GA + +D+ + Sbjct: 6 IIPCLDVDRGR---VVKGVNFVEIRDAGDPVEIAQRYDAEGADEITFLDITASHDERETM 62 Query: 65 AYIMEDIVSKFDVDVQVGGGIRDYETAKYLLSLGIDRVILGTAAIKNPDLVRQLADEFGS 124 +++E++ S+ + + VGGGIR E + LL+ G D+V + TAA+ NP+ VR+ A+ GS Sbjct: 63 VHVVEEVASQVFIPLTVGGGIRRVEDIRRLLNAGADKVSINTAAVYNPEFVREAAERVGS 122 Query: 125 ETVMVSLDSK---------QGEVVIEGWTESSGKTTNEMGKFFSEIGAGSILYTNVDVEG 175 + ++V++D+K Q E+ G + +G + + GAG IL T++D +G Sbjct: 123 QCIVVAIDAKRVSAPDEPPQWEIFTHGGRKHTGLDAVDWARRMVACGAGEILLTSMDRDG 182 Query: 176 LLKGVNEDPVRSLVNSVTIPVIASGGVAKIDDLVKIKNTGAAGVVVGSALYK-GLFTLRE 234 +G + + R++ ++V +PVIASGGV + LV G A V+ ++++ G T+ E Sbjct: 183 TRQGFDIELTRAVSDAVRVPVIASGGVGTLQHLVDGVTLGHADAVLAASIFHFGQHTVGE 242 Query: 235 A 235 A Sbjct: 243 A 243 Score = 36.6 bits (83), Expect = 5e-07 Identities = 20/87 (22%), Positives = 42/87 (48%) Query: 153 EMGKFFSEIGAGSILYTNVDVEGLLKGVNEDPVRSLVNSVTIPVIASGGVAKIDDLVKIK 212 E+ + + GA I + ++ + V + + V IP+ GG+ +++D+ ++ Sbjct: 34 EIAQRYDAEGADEITFLDITASHDERETMVHVVEEVASQVFIPLTVGGGIRRVEDIRRLL 93 Query: 213 NTGAAGVVVGSALYKGLFTLREAIDKV 239 N GA V + +A +REA ++V Sbjct: 94 NAGADKVSINTAAVYNPEFVREAAERV 120 Lambda K H 0.315 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 240 Length of database: 256 Length adjustment: 24 Effective length of query: 216 Effective length of database: 232 Effective search space: 50112 Effective search space used: 50112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory