Align aspartate transaminase; EC 2.6.1.1 (characterized)
to candidate WP_077279793.1 B1C78_RS13840 aspartate aminotransferase
Query= CharProtDB::CH_017144 (393 letters) >NCBI__GCF_002000365.1:WP_077279793.1 Length = 431 Score = 193 bits (491), Expect = 7e-54 Identities = 130/376 (34%), Positives = 196/376 (52%), Gaps = 22/376 (5%) Query: 1 MKLAKRVASLTPSATLAITEKAKELKAAGHDVIGLGAGEPDFNTPQHILDAAIKAMNEGH 60 ++L L SATLAI E+ ++ G V +G G+ F P+ +++A N Sbjct: 11 VQLNLNARGLPQSATLAINERCAAMRREGRSVFRMGLGQSPFPVPEPVVEAL--RANSHQ 68 Query: 61 TKYTPSGGLPALKEEIIKKFARDQGLDYEPAEVIVCVGAKHALYTLFQVLLDEGDEVIIP 120 Y P GLP L++ I+ R +GL + V+V G K ++ + L+ GD ++IP Sbjct: 69 KDYLPVKGLPELRQAIVDYLHRHEGLSFSADHVLVGPGTKELMFIV--QLVYYGD-LVIP 125 Query: 121 TPYWVSYPEQVKLAGGVPVYVEGLEQNHFKITPEQLKQA--ITP-RTKAVIINSPSNPTG 177 TP WVSY Q + G ++ + +TPE L + P R + +I+NSP NPTG Sbjct: 126 TPSWVSYAPQAHIIGRHLRWLPTHPETGLGVTPEALDALCRVDPDRPRLLILNSPGNPTG 185 Query: 178 MIYTAEELKALGEVCLAHGVLIVSDEIYEKLTYGGAKHVSIAELSPELKAQTVIINGVSK 237 Y E+L+A+ EV + VL++SDEIY L + G KHVSIA PE T+I NG+SK Sbjct: 186 SAYAVEQLQAIAEVARRYRVLVLSDEIYSGLHFEG-KHVSIARFYPE---GTIISNGLSK 241 Query: 238 SHSMTGWRIGYAAGPKD---IIKAMTDLASHSTSNPTSIAQYAAIAAYSGPQE---PVEQ 291 GWR+G A P+ +++ M +AS + ++ ++ QYAA+ A+ G E + Q Sbjct: 242 WCGAGGWRLGALAFPRSLTWLLEPMASVASETFTSTSAPIQYAAVRAFEGGPEIEHYLTQ 301 Query: 292 MRQAFEQRLNIIYDKLVQIPGFTCVKPQGAFYLFPN---AREAAAMAGCRTVDEFVAALL 348 R+ + ++ V+ G +P+G FYLFPN RE A G T ++ LL Sbjct: 302 CRRILRAIAHYTWES-VRAVGAVATEPKGGFYLFPNFDPLRERLASRGITTSEQLCLHLL 360 Query: 349 EEAKVALVPGSGFGAP 364 E+ VA +PG FG P Sbjct: 361 EDTGVACLPGEAFGRP 376 Lambda K H 0.316 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 17 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 431 Length adjustment: 31 Effective length of query: 362 Effective length of database: 400 Effective search space: 144800 Effective search space used: 144800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory