Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate WP_077280366.1 B1C78_RS17130 amino-acid N-acetyltransferase
Query= BRENDA::P22567 (432 letters) >NCBI__GCF_002000365.1:WP_077280366.1 Length = 445 Score = 480 bits (1235), Expect = e-140 Identities = 245/430 (56%), Positives = 305/430 (70%), Gaps = 2/430 (0%) Query: 5 VNWLRHASPYINSHRDRTFVVMLPGEGVEHPNFGNIVHDLVLLHSLGARLVLVHGSRPQI 64 +NW R+A+PYIN+HR RTFV+ GE V+ F ++HDL +L SLG RLVLVHG+RPQI Sbjct: 12 INWFRNAAPYINAHRGRTFVIAFGGEAVQDAGFAQLIHDLAMLQSLGVRLVLVHGARPQI 71 Query: 65 EARLAARGLAPRYHRDLRVTDAPTLECVIDAVGSLRIAIEARLSMDMAASPMQGARLRVA 124 E RL ARGLA RY LRVTDA L V +A G LR+ IEA LSM +A +PM GAR+RVA Sbjct: 72 EQRLRARGLAFRYEAGLRVTDADALAAVKEAGGCLRVEIEALLSMGLANTPMSGARIRVA 131 Query: 125 GGNLVTARPIGVVEGVDYHHTGEVRRIDRKGIGRLLDERSIVLLSPLGYSPTGEIFNLAC 184 GN V A+P+GV +GVDY HTGEVRRID +GI R L+ VLLSPLGYSPTGE+FNL+ Sbjct: 132 SGNHVIAKPLGVRDGVDYQHTGEVRRIDAEGIRRRLESGETVLLSPLGYSPTGEVFNLSA 191 Query: 185 EDVAMRAAIDLEAEKLILYGAEQGLLDASGKLVRELRPQQVPAHL--QRLGNSYQAELLD 242 EDVA AI L+A+KLI G D + V +L +Q L +R + A+ L Sbjct: 192 EDVATATAIALKADKLIFLTETPGPRDGRRRRVSQLSVEQAQVWLGGRRKLDPETAQHLK 251 Query: 243 AAAQACRAGVKRSHIVSYTEDGALLSELFTRTGNGTLVAQEQFEQLREAGIEDVGGLIEL 302 +A ACR GV R H+V DGALL EL+TR G GTL+ E +E++R A I+DVGG++EL Sbjct: 252 SAVHACRQGVARVHLVERNVDGALLLELYTRDGVGTLITGETYERMRRASIDDVGGILEL 311 Query: 303 IRPLEEQGILVRRSREVLEREIEQFSIVEREGLIIACAALYPIADSEAGELACLAVNPEY 362 I+PLE +GILVRRSRE LE EI++FS++ER+G+++ CAA YP GELACLA++PEY Sbjct: 312 IQPLEAEGILVRRSREQLELEIDRFSVIERDGIVLGCAAFYPFPAESVGELACLAIHPEY 371 Query: 363 RHGGRGDELLERIEERARGLGLKTLFVLTTRTAHWFRERGFQPSSVERLPAARASLYNFQ 422 R GRGD LLE +E A LG+ LFVLTTRTAHWFRERGF+P + LP + LYN+Q Sbjct: 372 RTAGRGDRLLEFVEAEAAALGIARLFVLTTRTAHWFRERGFEPGDIRNLPLRKRELYNYQ 431 Query: 423 RNSQVFEKSL 432 RNS++F K L Sbjct: 432 RNSKIFIKEL 441 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 587 Number of extensions: 23 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 445 Length adjustment: 32 Effective length of query: 400 Effective length of database: 413 Effective search space: 165200 Effective search space used: 165200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_077280366.1 B1C78_RS17130 (amino-acid N-acetyltransferase)
to HMM TIGR01890 (argA: amino-acid N-acetyltransferase (EC 2.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01890.hmm # target sequence database: /tmp/gapView.2845.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01890 [M=429] Accession: TIGR01890 Description: N-Ac-Glu-synth: amino-acid N-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.1e-187 607.1 0.2 1e-186 607.0 0.2 1.0 1 lcl|NCBI__GCF_002000365.1:WP_077280366.1 B1C78_RS17130 amino-acid N-acety Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002000365.1:WP_077280366.1 B1C78_RS17130 amino-acid N-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 607.0 0.2 1e-186 1e-186 2 429 .] 12 441 .. 11 441 .. 0.98 Alignments for each domain: == domain 1 score: 607.0 bits; conditional E-value: 1e-186 TIGR01890 2 vkwlreaaPyinahrdktlvvglggelvedknlgklvadiallhslGvrlvlvhGarpqieerlakrgr 70 ++w+r+aaPyinahr++t+v+++gge+v+d +++l++d+a+l+slGvrlvlvhGarpqie+rl +rg+ lcl|NCBI__GCF_002000365.1:WP_077280366.1 12 INWFRNAAPYINAHRGRTFVIAFGGEAVQDAGFAQLIHDLAMLQSLGVRLVLVHGARPQIEQRLRARGL 80 79******************************************************************* PP TIGR01890 71 tthyvrGlrvtdeaslelvkeaaGelrlaiearlsmslantpmagsrlsvvsGnfvtarPiGvveGvdy 139 +y Glrvtd+ +l vkea G lr +iea lsm lantpm+g+r++v+sGn v+a+P+Gv +Gvdy lcl|NCBI__GCF_002000365.1:WP_077280366.1 81 AFRYEAGLRVTDADALAAVKEAGGCLRVEIEALLSMGLANTPMSGARIRVASGNHVIAKPLGVRDGVDY 149 ********************************************************************* PP TIGR01890 140 ehtGevrkidaegirrlldersivllsPlgfsvtGeifnlamedvatsvaiklkadklillteedGild 208 +htGevr+idaegirr l++++ vllsPlg+s+tGe+fnl++edvat +ai+lkadkli+lte++G d lcl|NCBI__GCF_002000365.1:WP_077280366.1 150 QHTGEVRRIDAEGIRRRLESGETVLLSPLGYSPTGEVFNLSAEDVATATAIALKADKLIFLTETPGPRD 218 ********************************************************************* PP TIGR01890 209 adGklvaelsaqeveslverleeet..tarllsaavkalrgGvarshlvsyaedGallqelftrdGiGt 275 + v +ls ++++ + ++ ta+ l++av+a+r Gvar+hlv+ + dGall+el+trdG+Gt lcl|NCBI__GCF_002000365.1:WP_077280366.1 219 GRRRRVSQLSVEQAQVWLGGRRKLDpeTAQHLKSAVHACRQGVARVHLVERNVDGALLLELYTRDGVGT 287 **********999998874333221337***************************************** PP TIGR01890 276 lvskealesireatiddvggilelirPleeqGilvrrsrellereieefsviekdGliigcaalypyae 344 l++ e++e +r+a iddvggileli+Ple++Gilvrrsre+le ei++fsvie+dG+++gcaa+yp++ lcl|NCBI__GCF_002000365.1:WP_077280366.1 288 LITGETYERMRRASIDDVGGILELIQPLEAEGILVRRSREQLELEIDRFSVIERDGIVLGCAAFYPFPA 356 ********************************************************************* PP TIGR01890 345 eevgelaclavsPeardggrGerllkhiedrarqvGlkrlfvlttrtehWfrerGfaeasvdelPearr 413 e+vgelacla++Pe+r +grG+rll+ +e+ a ++G+ rlfvlttrt+hWfrerGf++ ++ +lP +r lcl|NCBI__GCF_002000365.1:WP_077280366.1 357 ESVGELACLAIHPEYRTAGRGDRLLEFVEAEAAALGIARLFVLTTRTAHWFRERGFEPGDIRNLPLRKR 425 ********************************************************************* PP TIGR01890 414 klynyqrrskilvkkl 429 +lynyqr+ski++k+l lcl|NCBI__GCF_002000365.1:WP_077280366.1 426 ELYNYQRNSKIFIKEL 441 *************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (429 nodes) Target sequences: 1 (445 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.91 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory