Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate WP_078427052.1 BK574_RS00635 methionine gamma-lyase
Query= SwissProt::P55218 (403 letters) >NCBI__GCF_002019605.1:WP_078427052.1 Length = 392 Score = 281 bits (719), Expect = 2e-80 Identities = 146/377 (38%), Positives = 227/377 (60%), Gaps = 1/377 (0%) Query: 25 RAGQRRTPEGEHGEALFTTSSYVFRTAADAAARFAGEVPGNVYSRYTNPTVRTFEERIAA 84 R + ++ +G LF +S++ +A RFAG+ G +YSR NPTV EERIA Sbjct: 13 RGYESKSFQGSLTPPLFQSSTFTMESAEQGERRFAGDEEGYIYSRLGNPTVTILEERIAE 72 Query: 85 LEGAEQAVATASGMSAILALVMSLCSSGDHVLVSRSVFGSTISLFDKYFKRFGIQVDYPP 144 LEG E +A +SGM+A+ A + +L SGDH+LVS V+G T L + RF + D Sbjct: 73 LEGGEAGLAFSSGMAAVSATLFALVRSGDHILVSEGVYGCTYGLLELLKDRFKVDYDLIA 132 Query: 145 LSDLAAWEAACKPNTKLFFVESPSNPLAELVDIAALAEIAHAKGALLAVDNCFCTPALQQ 204 + + +P TK+ +VE+P NP +LVD+ ++++ GA + VDN F TP LQ+ Sbjct: 133 MDKEEHIRSYIRPETKVIYVETPINPTMKLVDLQLISKLGKETGAKVVVDNTFATPYLQR 192 Query: 205 PLKLGADVVIHSATKYIDGQGRGMGGVVAGRGEQMKEV-VGFLRTAGPTLSPFNAWLFLK 263 P+ LGADVV+HSATKYI G G + G++ G E + EV + + G +SPF+AWL ++ Sbjct: 193 PILLGADVVVHSATKYISGHGDVVAGLMVGSEEFINEVRMTTQKDIGGIISPFDAWLLIR 252 Query: 264 GLETLRIRMQAHSASALALAEWLERQPGIERVYYAGLPSHPQHELARRQQSGFGAVVSFD 323 GL+TL +RM H ++A+ +A ++ P I+ + + G S Q ++ +Q G ++SF Sbjct: 253 GLKTLPVRMDRHCSNAIQIANKMKNHPKIKEIIFPGDESFSQVDVIEKQMKQAGGMISFL 312 Query: 324 VKGGRDAAWRFIDATRMVSITTNLGDTKTTIAHPATTSHGRLSPEDRARAGIGDSLIRVA 383 V GG++ A R ++ +++ I +LGD +T I HPAT +H + E RA+ GIG L+R++ Sbjct: 313 VNGGKETAQRLMNELKLIKIAVSLGDAETLIQHPATMTHSVVPEEKRAQMGIGPELLRLS 372 Query: 384 VGLEDLDDLKADMARGL 400 VGLE +D+ D+ + L Sbjct: 373 VGLEAWEDIWVDIEQAL 389 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 392 Length adjustment: 31 Effective length of query: 372 Effective length of database: 361 Effective search space: 134292 Effective search space used: 134292 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory