Align homoserine dehydrogenase (EC 1.1.1.3) (characterized)
to candidate WP_078428971.1 BK574_RS13545 homoserine dehydrogenase
Query= BRENDA::D8WXQ2 (413 letters) >NCBI__GCF_002019605.1:WP_078428971.1 Length = 412 Score = 238 bits (606), Expect = 3e-67 Identities = 145/414 (35%), Positives = 232/414 (56%), Gaps = 29/414 (7%) Query: 1 MSTIHIALLGYGTVGKGVYQTIKTHQKRFKAILGKEVKIEAVLVKNLEKHQ--------- 51 M + I ++GYGTVG GVY+ + + ++ ++ L KE++++ VLV++ +K + Sbjct: 1 MRLLSIGIIGYGTVGSGVYERLTSSKEELQSALKKEIQVKKVLVRDCKKERNNQGAKQCM 60 Query: 52 LPDPDVILTNKFEDIISLPKLDVVIDAIVGKQPGFSYLSQAIKRGCHIITANKQMFAHYG 111 DP N++ DVV +AI G +P Y+ + I+ G IITANK++ A +G Sbjct: 61 TSDPVNFFQNQY---------DVVFEAIGGVEPARDYIIKLIQAGTSIITANKELIAKHG 111 Query: 112 RELLSLAEKHGVSVGFEATVAGGIPVIQTLRKLLSVNHIKKVHGILNGTSNFILTKMREE 171 EL LA+++ V +GFEA V GGIP++ + + L + I+ V GILNGT+N+ILT+M+E+ Sbjct: 112 AELEKLAKEYQVYLGFEAAVGGGIPIVNSFKTLFTTTPIRSVSGILNGTTNYILTEMKEK 171 Query: 172 GCSFSDALSLAQEKGYAEADPTNDVEGFDAFYKAMILSEVVYGKQPDWEKVRKQGISSIT 231 F D L+ A+ GYAEADPT+D+EG+DA YK ILS + + + P E +GIS + Sbjct: 172 NRQFDDVLAEAKVLGYAEADPTDDIEGYDALYKIRILSRLAFNEWPREENFSCKGISGME 231 Query: 232 LEQIELFSKFGLRFKHVASLEKTTKGIHCSVKPVLVSSSHPLFHVEDVQNAVSIDADIVG 291 +E IE + GL K +A I V P V+ +HPL+++ V N V ID + V Sbjct: 232 VEAIEFAERQGLTIKLIAKTANEDGVISGFVSPSFVTQTHPLYNINGVTNGVCIDGETVD 291 Query: 292 NISLQGPGAGMFPTASAIVEDLI---QLETERARPDEGADHASFAHEPLLTWVLYGEVKN 348 I++ GPGAG TA+++VED + Q + R ++ S ++ +V E + Sbjct: 292 CITMSGPGAGKEATANSMVEDFVLHEQFQGFERRKVRLSNQVSNKETKVVVFVDEFEKEE 351 Query: 349 L-----EIPESIEIIGKINAKALLV--LAKEESIENLSNKIKGITVYQLLGDFT 395 + I + I+ +N K L+ L +++ +L I+ + Y LLGDF+ Sbjct: 352 VVLQLRTISDCIDTEDTMNGKLALIVKLGYGKTVYDLETLIQK-SSYPLLGDFS 404 Lambda K H 0.317 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 413 Length of database: 412 Length adjustment: 31 Effective length of query: 382 Effective length of database: 381 Effective search space: 145542 Effective search space used: 145542 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory