Align Methionine synthase component, B12 binding and B12-binding cap domains (EC:2.1.1.13) (characterized)
to candidate WP_078430828.1 BK574_RS10060 methionine synthase
Query= reanno::Phaeo:GFF1319 (233 letters) >NCBI__GCF_002019605.1:WP_078430828.1 Length = 1148 Score = 107 bits (266), Expect = 1e-27 Identities = 68/214 (31%), Positives = 112/214 (52%), Gaps = 9/214 (4%) Query: 18 LVQQMFDDLYDGLKEEIEESVNILLERGWAPYKVLTEALVGGMTIVGADFRDGILFVPEV 77 L +++ + +G KE + E + LE+ P ++ L+ GM VG F + L V EV Sbjct: 625 LEERLASYIVEGTKEGLIEDLKQALEKYTEPLDIINGPLMNGMDEVGRLFNNNELIVAEV 684 Query: 78 LLAANAMKGGMAILKPLLAE-TGAPRMGSMVIGTVKGDIHDIGKNLVSMMMEGAGFEVVD 136 L +A MK +A L+ + + +G G +++ TVKGD+HDIGKNLV +++ GF++V+ Sbjct: 685 LQSAEVMKASVAFLEQYMEKKSGDNGKGKILLATVKGDVHDIGKNLVEIILGNNGFKIVN 744 Query: 137 IGINNPVENYLEALEEHQPDILGMSALLTTTMPYMKVVIDTMIEQGKRDDYIVLVGGAPL 196 +GI +EA++ PD +G+S LL + M + + EQ +LVGGA L Sbjct: 745 LGIKVTSNELIEAVKRENPDAIGLSGLLVKSAQQMVLTAQDLKEQ--NISIPILVGGAAL 802 Query: 197 NEEF------GKAIGADGYCRDAAVAVEMAKDFV 224 +F + G Y +DA +++A V Sbjct: 803 TRKFTDNRISREYDGVVLYAKDAMNGLDLANKLV 836 Lambda K H 0.318 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 582 Number of extensions: 37 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 1148 Length adjustment: 34 Effective length of query: 199 Effective length of database: 1114 Effective search space: 221686 Effective search space used: 221686 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory