Align pyrroline-5-carboxylate reductase (EC 1.5.1.2) (characterized)
to candidate WP_078715724.1 B5D49_RS00655 pyrroline-5-carboxylate reductase
Query= reanno::DvH:207819 (265 letters) >NCBI__GCF_900167125.1:WP_078715724.1 Length = 263 Score = 216 bits (550), Expect = 4e-61 Identities = 117/260 (45%), Positives = 165/260 (63%), Gaps = 1/260 (0%) Query: 5 LGCIGCGNMGSAILRGLSGREGLRLVGCDPTGAKLAALAD-AGVEGVADIAAAVRASDIV 63 +G IG GNMG+AI+ LSG EG+ L G + T +KL LA G+ D+ SD V Sbjct: 3 IGFIGTGNMGAAIIEALSGMEGITLYGVNRTRSKLEELAARTGLIPCGDVRELTEKSDFV 62 Query: 64 LVAVKPGQVGAVLGAAMPELDSGKVVVSIASGVSVGSLREMSGGRCPVVRVMPNTPAMVG 123 ++AVKP QVG V A +P L S K ++SIA+G+++ SL++ G CPV+RVMP TP +V Sbjct: 63 VLAVKPQQVGEVWPAMVPALSSDKCMISIAAGLTLESLQQSIGHACPVIRVMPITPVLVK 122 Query: 124 AGVFALCFEDATLDEVRRTLVKELFEALGRVLVLPEEKFNAFTAVVGCGPAYVFHFMEAV 183 GV A+C +D TL + ++ V+ +F G V ++ E F+ FTA++G GPA +FH ME + Sbjct: 123 EGVTAVCLDDKTLTQEQKDAVQRIFSPSGDVHIVAENLFDVFTALIGSGPALLFHLMETL 182 Query: 184 VEAAVTLGFPRHEATDMVVDLFAGSVKLAATSGTHLSLLREAVCSPAGNTIAAMNQFDRD 243 +E+ V LG R A+ MV LF G+ +A S H+SLL+E +PAG T AA+ F+R Sbjct: 183 IESGVELGIERAAASRMVKKLFRGAGIMAEQSEQHISLLKEMSIAPAGTTNAALAHFERT 242 Query: 244 AVRGRIIDAILAAYRRGQEM 263 A+RG I+DAI AY R E+ Sbjct: 243 AIRGNIMDAIRKAYERSIEL 262 Lambda K H 0.322 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 263 Length adjustment: 25 Effective length of query: 240 Effective length of database: 238 Effective search space: 57120 Effective search space used: 57120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate WP_078715724.1 B5D49_RS00655 (pyrroline-5-carboxylate reductase)
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00112.hmm # target sequence database: /tmp/gapView.9488.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00112 [M=263] Accession: TIGR00112 Description: proC: pyrroline-5-carboxylate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-73 234.2 1.3 1.2e-73 234.0 1.3 1.0 1 lcl|NCBI__GCF_900167125.1:WP_078715724.1 B5D49_RS00655 pyrroline-5-carbox Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900167125.1:WP_078715724.1 B5D49_RS00655 pyrroline-5-carboxylate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 234.0 1.3 1.2e-73 1.2e-73 1 263 [] 3 262 .. 3 262 .. 0.97 Alignments for each domain: == domain 1 score: 234.0 bits; conditional E-value: 1.2e-73 TIGR00112 1 iaiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaeeavkeadvvllavKP 69 i++iG Gnmg+a++++l+ + + ++ ++r +kl++la+++g + d++e+ +++d+v+lavKP lcl|NCBI__GCF_900167125.1:WP_078715724.1 3 IGFIGTGNMGAAIIEALSGMEGI---TLYGVNRTRSKLEELAARTGLIPCGDVRELTEKSDFVVLAVKP 68 89**************9987555...79999999*********************************** PP TIGR00112 70 qdleevlaelkseektkeklliSilAGvtiekleqlleaekrvvRvmPNtaakvgagvtaiaassevse 138 q++ ev + + +k++iSi+AG+t+e l+q +++ ++v+RvmP t++ v++gvta++ ++++ lcl|NCBI__GCF_900167125.1:WP_078715724.1 69 QQVGEVWPAMVP-ALSSDKCMISIAAGLTLESLQQSIGHACPVIRVMPITPVLVKEGVTAVCLDDKTLT 136 ********9988.7779*********************************************9988777 PP TIGR00112 139 e.qkelveellkavGkvveveeklldavtalsGSgPAfvflliealadagvklGLpreeakelaaqtlk 206 + qk+ v+++++ G+v+ v+e+l+d +tal GSgPA +f+l+e l+++gv+lG++r+ a +++++++ lcl|NCBI__GCF_900167125.1:WP_078715724.1 137 QeQKDAVQRIFSPSGDVHIVAENLFDVFTALIGSGPALLFHLMETLIESGVELGIERAAASRMVKKLFR 205 66******************************************************************* PP TIGR00112 207 GaaklleesgehpalLkdkVtsPgGtTiaglavLeekgvrsavieaveaavkrseeL 263 Ga+ + e+s++h +lLk+ + P+GtT a+la +e+ ++r+ +++a+++a++rs eL lcl|NCBI__GCF_900167125.1:WP_078715724.1 206 GAGIMAEQSEQHISLLKEMSIAPAGTTNAALAHFERTAIRGNIMDAIRKAYERSIEL 262 *****************************************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (263 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 9.85 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory