Align histidinol-phosphate aminotransferase (EC 2.6.1.9) (characterized)
to candidate WP_078715991.1 B5D49_RS02160 histidinol-phosphate transaminase
Query= reanno::DvH:206463 (373 letters) >NCBI__GCF_900167125.1:WP_078715991.1 Length = 363 Score = 397 bits (1019), Expect = e-115 Identities = 194/359 (54%), Positives = 252/359 (70%) Query: 12 VRPEVLDFKPYVPGLSIDEIRDRFGLADVVKLASNENPLGTSPVVQRTLKTKADLAFRYA 71 VR ++LDFKPY PGL++++IR+ +G+ V+KLASNENPLG SPVVQ+ L KA FRY Sbjct: 5 VRKQILDFKPYTPGLTLEDIREEYGVERVIKLASNENPLGVSPVVQKVLGQKAAEVFRYP 64 Query: 72 QSGNPRLTRAIAAHHGVAPERVVAGNGSDEIIDLLIRVRATPGKHNIVAFRPCFSIYELQ 131 Q+ +PRL A+A GV P+ VV GNGSDEIID+L RV A PG+ N+V + FS+Y + Sbjct: 65 QNHSPRLAAALAERLGVEPDMVVVGNGSDEIIDMLYRVVAEPGRDNVVCYEHSFSMYRMC 124 Query: 132 AKFCGLEFRQADLRPDFTFDWDAFLAATDENTAIAFVTTPDNPSGWCPPVSELEHVARTL 191 AK CG+E+R+ + A DE+TA+ F+T+PDNP+G E+ ++R L Sbjct: 125 AKLCGVEYREIPREHGLGLPMEHLARAADEHTALVFLTSPDNPTGLAATADEIAKLSRAL 184 Query: 192 PPSCLFVIDEAYMDFCGDEAAHSLLSRLDAFPNIAVLRTFSKSFGLAGLRLGYGILPERL 251 P L V+D AY +F + + RL N+ +LRTFSK++GLAG+RLGYGI+P L Sbjct: 185 PEGALLVVDGAYAEFAEPQDIYEAAPRLAELDNLVLLRTFSKAYGLAGMRLGYGIMPAWL 244 Query: 252 ADYLHRVRLPFSVNILAEEAGLAALEDTVFRSETLRVTAEGRAYIAEGLTALGCEVMPSW 311 A YL R R+PF+VN+ AE AGLAALED VF SETLRV EGR Y+ L ALGCEV PS Sbjct: 245 ASYLRRARIPFTVNLPAEAAGLAALEDEVFLSETLRVVCEGRDYLGRELAALGCEVTPSQ 304 Query: 312 ANFIMFRPPTDATDLFEALLRRGIIIRPLKSYGLPQHLRVSVGNADENRRFIEACKEIL 370 ANF+MFRPP+DAT FE +LRRGII+R LKS+GLP H+RV++G ENR F+ AC+E+L Sbjct: 305 ANFLMFRPPSDATVFFEGMLRRGIIVRHLKSFGLPDHIRVNMGTESENRAFVSACRELL 363 Lambda K H 0.323 0.139 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 436 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 363 Length adjustment: 30 Effective length of query: 343 Effective length of database: 333 Effective search space: 114219 Effective search space used: 114219 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
Align candidate WP_078715991.1 B5D49_RS02160 (histidinol-phosphate transaminase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.18465.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-103 332.6 0.0 1.4e-103 332.4 0.0 1.0 1 lcl|NCBI__GCF_900167125.1:WP_078715991.1 B5D49_RS02160 histidinol-phospha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900167125.1:WP_078715991.1 B5D49_RS02160 histidinol-phosphate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 332.4 0.0 1.4e-103 1.4e-103 1 348 [. 6 361 .. 6 362 .. 0.98 Alignments for each domain: == domain 1 score: 332.4 bits; conditional E-value: 1.4e-103 TIGR01141 1 rekikklepYqpg......arelgekevvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkea 63 r++i +++pY+pg +e+g + v+kL+snEnP+g+s+ v++ l ++++++ rYp++++ +l +a lcl|NCBI__GCF_900167125.1:WP_078715991.1 6 RKQILDFKPYTPGltlediREEYGVERVIKLASNENPLGVSPVVQKVLGQKAAEVFRYPQNHSPRLAAA 74 78999*************999*********************9999999******************** PP TIGR01141 64 lakylgveeenillgnGsdelielliraflepg.davlvleptysmYevsakiagaevkevplkedgqe 131 la++lgve++ +++gnGsde+i++l r ++epg d+v+ e+++smY+++ak++g+e++e+p ++ lcl|NCBI__GCF_900167125.1:WP_078715991.1 75 LAERLGVEPDMVVVGNGSDEIIDMLYRVVAEPGrDNVVCYEHSFSMYRMCAKLCGVEYREIPREHGLGL 143 ******************************************************************888 PP TIGR01141 132 dleavleaakekvklvflasPnnPtGnllkreeiekvleev.edalVVvDeAYieFsee...asvlell 196 +e+++ aa+e++ lvfl+sP+nPtG +++ei k+ + e al VvD AY eF+e +++++ l lcl|NCBI__GCF_900167125.1:WP_078715991.1 144 PMEHLARAADEHTALVFLTSPDNPTGLAATADEIAKLSRALpEGALLVVDGAYAEFAEPqdiYEAAPRL 212 9999999**********************************88**************99889999**** PP TIGR01141 197 aeypnlvvlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektvee 265 ae +nlv lrT+SKa+gLAg+R+Gy+i+ a ++++l++ r p+ v+ +a +a++aal+d+ ++++t++ lcl|NCBI__GCF_900167125.1:WP_078715991.1 213 AELDNLVLLRTFSKAYGLAGMRLGYGIMPAWLASYLRRARIPFTVNLPAEAAGLAALEDEVFLSETLRV 281 ********************************************************************* PP TIGR01141 266 vkkererlleelkkleglevyeSkaNFvlikvkedaeelleallekgiivRdlksaeglleeclRitvG 334 v ++r++l el++l g ev +S+aNF++++ ++da+ ++e +l++giivR+lks+ gl ++++R+ +G lcl|NCBI__GCF_900167125.1:WP_078715991.1 282 VCEGRDYLGRELAAL-GCEVTPSQANFLMFRPPSDATVFFEGMLRRGIIVRHLKSF-GL-PDHIRVNMG 347 ***************.8***************************************.85.********* PP TIGR01141 335 treenerllealke 348 t++en++++ a +e lcl|NCBI__GCF_900167125.1:WP_078715991.1 348 TESENRAFVSACRE 361 *********99887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (363 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 12.06 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory