Align Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 (uncharacterized)
to candidate WP_078717186.1 B5D49_RS08095 glutamate-1-semialdehyde-2,1-aminomutase
Query= curated2:Q8TUZ5 (389 letters) >NCBI__GCF_900167125.1:WP_078717186.1 Length = 422 Score = 143 bits (361), Expect = 8e-39 Identities = 107/314 (34%), Positives = 149/314 (47%), Gaps = 23/314 (7%) Query: 19 PVTLVPGEGARVWDDEGNEYIDLVAGIAVNVLGHCHPAVVEAVKEQVERLIHCSNLYYNE 78 P+ + G+++W +G E +D + +LGH HPAV EA V E Sbjct: 33 PLFVTKTAGSKMWTADGQELVDYIMSWGPMLLGHAHPAVEEAAVRAVRAGASFGTPC--E 90 Query: 79 PQAEAARLLAEAAPKDLNKVFFCNSGTESVECAIKLARKFTGCTKFIAFEGGFHGRT--- 135 + A LL E P ++ V NSGTE+ A++LAR +TG K I F GG+HG + Sbjct: 91 DEVLLAELLCEILPS-VDMVRMVNSGTEATMSALRLARAYTGRDKVIKFHGGYHGHSDCF 149 Query: 136 -------MGALSATWKPEFREPFEPLVPEFEHVPYGDVNAVEKAIDD---DTAAVIVEPV 185 M LS P E F V Y D+ V + ++ + AAV VEPV Sbjct: 150 LASAGSGMATLSIPGTPGVPETF---VAGTLLAHYNDLAGVRQLFEENPEEVAAVFVEPV 206 Query: 186 QGEAGVRIPPEGFLRELRELCDEHGLLLIVDEVQSGMGRTGQFFAFEHEDVLPDIVCLAK 245 G G +P EG+L LR LCDE G LL+ DEV +G R A + + PD+ CL K Sbjct: 207 AGNMGCVLPGEGWLSGLRALCDEFGALLVFDEVITGF-RVDLGGAQKRFGIDPDLTCLGK 265 Query: 246 GLGGGVPVGATIAREEVAEAFEP-GD--HGSTFGGNPLACAAVCAAVSTVLEENLPEAAE 302 +GGG PVG + + E P GD T GNP+A AA A + + +++ + Sbjct: 266 IIGGGFPVGCYGGKRKFMERIAPCGDVYQAGTLSGNPVAMAAGLATLRELQKQDYAALEK 325 Query: 303 RKGKLAMRILSEAE 316 R +LA + S E Sbjct: 326 RTLELATELKSILE 339 Lambda K H 0.318 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 360 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 422 Length adjustment: 31 Effective length of query: 358 Effective length of database: 391 Effective search space: 139978 Effective search space used: 139978 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory