Align LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 (uncharacterized)
to candidate WP_078717662.1 B5D49_RS10555 pyridoxal phosphate-dependent aminotransferase
Query= curated2:B1I544 (392 letters) >NCBI__GCF_900167125.1:WP_078717662.1 Length = 392 Score = 159 bits (403), Expect = 1e-43 Identities = 115/382 (30%), Positives = 175/382 (45%), Gaps = 12/382 (3%) Query: 6 AKRIRNLPPYLFARIEQLIADKKAQGVDVISLGIGDPDVPTPDHIIEAAEKELKIPANHQ 65 + R + +L I + + QG ++I + IG+PD TP+ + EAA + L H Sbjct: 10 SSRCNEMTSFLVMDILEAAQRLERQGKNIIHMEIGEPDFDTPECVKEAACRALADNKTH- 68 Query: 66 YPSSAGMPAYRRAVADWYARRFGVELDPQREVVSLIGSKEGIAHLPWCFVDPGDVVLVPD 125 Y S G+P R AV + Y ++GVE+ P + +V+ G+ + L ++ GD V+V D Sbjct: 69 YTHSLGIPELREAVCEHYLDQYGVEVHPDQIIVTQ-GTSPAMFVLFSSLLERGDKVVVSD 127 Query: 126 PGYPVYAGGTILAGGIPHPVPLTAGNGFLPDLAAIPAETARRAKVMFINYPNNPTGAVAS 185 P Y Y+ GG P PV + + F AI + K + +N P+NPTG + S Sbjct: 128 PCYACYSNFIRFPGGEPLPVRVREDDAFQYRPEAIAHCLEQHPKAIMLNSPSNPTGTLLS 187 Query: 186 KEFFARVVDFAREYGILVCHDAAYSEIAFDGYRPPSFLEVAGAREVGIEFHSVSKTYNMT 245 E + + R G + D Y + ++G R S LE + F+ SK Y MT Sbjct: 188 AERMRAIAEMGRGDGPWLVSDEIYHGLVYEG-REHSILEFT---DKAFVFNGFSKLYAMT 243 Query: 246 GWRAGWAAGNAGAVEALGRLKSNLDSGVFQVVQYAAIAALNGPQDGVQSLCEMYRERRDL 305 GWR G+ + + +L N Q+ +AAL VQ + Y RR Sbjct: 244 GWRLGYLIAPKAFIRPMQKLCQNFFISANAPAQWGGVAALREAGQDVQEMKARYDRRRKY 303 Query: 306 VVDTLNDLGWRL-TRPRATFYIWAPVPAGH---DASSFAEMVLEKAGVVITPGTGYGTYG 361 ++ L +G R+ P FYI V H D+ + A +LEKA + +TPG +G Sbjct: 304 MLQRLRGMGLRIDNEPTGAFYIL--VDFNHLSGDSLALAYDMLEKAHIGVTPGIDFGPGA 361 Query: 362 EGYFRISLTLPTPRLVEAMERL 383 EGY R S + E M+RL Sbjct: 362 EGYLRFSYATSLENITEGMDRL 383 Lambda K H 0.321 0.139 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 392 Length adjustment: 31 Effective length of query: 361 Effective length of database: 361 Effective search space: 130321 Effective search space used: 130321 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory