Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25) (characterized)
to candidate WP_078717840.1 B5D49_RS11430 shikimate dehydrogenase
Query= BRENDA::Q5SJF8 (263 letters) >NCBI__GCF_900167125.1:WP_078717840.1 Length = 268 Score = 175 bits (444), Expect = 8e-49 Identities = 113/269 (42%), Positives = 151/269 (56%), Gaps = 8/269 (2%) Query: 1 MLRFAVLGHPVAHSLSPAMHAFALESLGLEGSYEAWDTPLEALPGRLKEVRRA-FRGVNL 59 M ++ ++GHP+ HSLSPA+H + ++ Y+ WDTP ++L + VR RGV++ Sbjct: 1 MEQYGIIGHPLGHSLSPALHNWGFARWSMDAVYDFWDTPPDSLAAFVDRVRAENIRGVSV 60 Query: 60 TLPLKEAALAHLDWVSPEAQRIGAVNTVLQVE-GRLFGFNTDAPGFLEALKAGGIPLKGP 118 T+P K + LD VS A+ IGAVNT+ E GRL G NTD G LE L+ IP Sbjct: 61 TIPHKRTIMPLLDRVSTTARAIGAVNTICWDEHGRLRGTNTDVAGCLEPLRRV-IPKPKT 119 Query: 119 ALVLGAGGAGRAVAFALREAGLE-VWVWNRTPQRALALAEEFGLRAVPLEKARE--ARLL 175 ALVLGAGGA RA AL + G+E V V NR P++A ALA EF + AV ++ + +L Sbjct: 120 ALVLGAGGAARAAIAALNQLGVEWVGVSNRNPEKADALALEFSIHAVRWDERHKNPCDVL 179 Query: 176 VNATRVGLEDP--SASPLPAELFPEEGAAVDLVYRPLWTRFLREAKAKGLKVQTGLPMLA 233 VNAT +G+ P +P P + P++ DLVY PL T L AK G +GL M Sbjct: 180 VNATPLGMSGPYQGQNPWPMKALPQDTTVFDLVYNPLETPLLALAKTCGCGRISGLEMFL 239 Query: 234 WQGALAFRLWTGLLPDPSGMEEAARRALG 262 QG F +WTG DP E + LG Sbjct: 240 HQGLKQFHIWTGQDLDPDAARERLLQELG 268 Lambda K H 0.320 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 268 Length adjustment: 25 Effective length of query: 238 Effective length of database: 243 Effective search space: 57834 Effective search space used: 57834 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate WP_078717840.1 B5D49_RS11430 (shikimate dehydrogenase)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.2029.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-71 225.8 0.0 3.2e-71 225.6 0.0 1.0 1 lcl|NCBI__GCF_900167125.1:WP_078717840.1 B5D49_RS11430 shikimate dehydrog Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900167125.1:WP_078717840.1 B5D49_RS11430 shikimate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 225.6 0.0 3.2e-71 3.2e-71 2 269 .. 3 267 .. 2 268 .] 0.95 Alignments for each domain: == domain 1 score: 225.6 bits; conditional E-value: 3.2e-71 TIGR00507 2 llgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlel 70 +g+iG+p hS+sp++hn ++ ++ +Y ++++++l +++ ++a+ ++Gv+vT+P+K +++l lcl|NCBI__GCF_900167125.1:WP_078717840.1 3 QYGIIGHPLGHSLSPALHNWGFARWSMDAVYDFWDTPPDSLAAFVDRVRAENIRGVSVTIPHKRTIMPL 71 69******************************************************************* PP TIGR00507 71 lDeieesakligavNTlk.ledgklvgynTDgiGlvssLeklsklksekrvliiGAGGaakavaleLlk 138 lD+++ +a++igavNT+ e g+l g nTD+ G + L+++ +k k++l++GAGGaa+a++ +L + lcl|NCBI__GCF_900167125.1:WP_078717840.1 72 LDRVSTTARAIGAVNTICwDEHGRLRGTNTDVAGCLEPLRRV-IPK-PKTALVLGAGGAARAAIAALNQ 138 ******************7889*******************3.333.58******************** PP TIGR00507 139 adke.viiaNRtvekaeelaerlqelgeilalsleevelkkvdliinatsaglsgeid.eaevkaellk 205 + e v + NR eka +la ++ a+ +e +++ d+++nat++g+sg+ + + + + + l lcl|NCBI__GCF_900167125.1:WP_078717840.1 139 LGVEwVGVSNRNPEKADALALEFSI----HAVRWDERHKNPCDVLVNATPLGMSGPYQgQNPWPMKALP 203 *765388*********999999976....888888999999*****************99********* PP TIGR00507 206 egklvvDlvynpletpllkeakkkgtkvidGlgMlvaQaalsFelwtgvepdvekvfealkekl 269 +++ v+Dlvynpletpll++ak g+ i Gl+M+ +Q++++F++wtg+ d + ++e+l ++l lcl|NCBI__GCF_900167125.1:WP_078717840.1 204 QDTTVFDLVYNPLETPLLALAKTCGCGRISGLEMFLHQGLKQFHIWTGQDLDPDAARERLLQEL 267 **************************************************99999999998877 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (268 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 5.93 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory