Align Methionine synthase component, B12 binding and B12-binding cap domains (EC:2.1.1.13) (characterized)
to candidate WP_078718028.1 B5D49_RS12400 methionine synthase
Query= reanno::Phaeo:GFF1319 (233 letters) >NCBI__GCF_900167125.1:WP_078718028.1 Length = 806 Score = 126 bits (316), Expect = 1e-33 Identities = 70/204 (34%), Positives = 119/204 (58%), Gaps = 2/204 (0%) Query: 22 MFDDLYDGLKEEIEESVNILLERGWAPYKVLTEALVGGMTIVGADFRDGILFVPEVLLAA 81 +F + G K+ I V L++G P+ ++ E L+ + VG + F+P+++ +A Sbjct: 603 LFSAVVKGNKDGITALVQDALDQGNGPFDLVDEHLIPAIMDVGEKYERKEYFLPQLIQSA 662 Query: 82 NAMKGGMAILKPLL-AETGAPRMGSMVIGTVKGDIHDIGKNLVSMMMEGAGFEVVDIGIN 140 ++ IL PL+ A++G +++ TV+GDIHDIGKN+V +M+ GF VVD+G + Sbjct: 663 ETLQNAFKILNPLMEADSGKQERPCVIMATVEGDIHDIGKNIVCLMLRNHGFNVVDLGKD 722 Query: 141 NPVENYLEALEEHQPDILGMSALLTTTMPYMKVVIDTMIEQGKRDDYIVLVGGAPLNEEF 200 + ++A E ++G+SAL+TTTM M+ + + E+G + V++GGA + E F Sbjct: 723 VTADRIVQAAAEEGAKLVGLSALMTTTMVRMEDTVRLLREKG-LEHVKVMIGGAVVTEAF 781 Query: 201 GKAIGADGYCRDAAVAVEMAKDFV 224 ++IGA G DA AV++AK V Sbjct: 782 AESIGAHGCSTDAVTAVKLAKQLV 805 Lambda K H 0.318 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 435 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 806 Length adjustment: 32 Effective length of query: 201 Effective length of database: 774 Effective search space: 155574 Effective search space used: 155574 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory