Align Histidinol-phosphate aminotransferase; EC 2.6.1.9 (characterized, see rationale)
to candidate WP_081432225.1 HHAL_RS10665 histidinol-phosphate transaminase
Query= uniprot:A0A2R7PAQ8 (373 letters) >NCBI__GCF_000015585.1:WP_081432225.1 Length = 380 Score = 262 bits (670), Expect = 1e-74 Identities = 147/361 (40%), Positives = 217/361 (60%), Gaps = 13/361 (3%) Query: 15 IRPDVRAMHSYVVQPSTGMLKMDAMENPFRLPAHLQAALGQRLGSVALNRYPGDRIADLK 74 +RP V+A+ +Y V +K+DAME+P+ P L+ A +R+ SV++NRYP LK Sbjct: 27 VRPQVQALEAYQVAEPGKAIKLDAMESPWAWPGALEEAWLERMRSVSVNRYPDPAARRLK 86 Query: 75 AALAQYAGMPEGYGIVLGNGSDELITLLALACAQPGTGQRATMLAPMPGFVMYPLSAQLQ 134 L + G+PEG ++LGNGSDELI L+ LA A G T++AP P F MY + A+ Sbjct: 87 PLLREGLGVPEGAELLLGNGSDELIQLIDLAVA----GSGRTVMAPGPSFAMYRIIAEYT 142 Query: 135 GLDFVGVPLTPDFELDEPAMLAAIGQHRPAITYIAYPNNPTATLWDEGAVQRIIDAAGAQ 194 G ++V VPL +F LD A A+ + PA+TY+A+PNNPT D AV ++ Sbjct: 143 GAEYVEVPLDAEFGLDLAATREAVSAYNPAVTYLAHPNNPTGNGLDLDAVAELV---AQS 199 Query: 195 GGIVVMDEAYQPFASRTWIDRMRAEPARNAHVLLMRTLSKFGLAGVRLGYLIGPSAFVSE 254 G+VV+DEAY P+A +++ R+ P + L++RTLSK GLAG+R+G LIG A++ + Sbjct: 200 DGLVVVDEAYAPYADSSFLPRVLEFP----NCLVLRTLSKVGLAGLRVGVLIGHPAWIDQ 255 Query: 255 IDKVRPPYNVSVLNCEAALFALEHAEVFAAQAAEIRVERATLIAALRQMPGVEKCWDSEA 314 ++K R PYN+ L +A FA+EH E A + ERA L+ L +PGVE+ W ++ Sbjct: 256 LEKCRLPYNLGSLAQASAAFAVEHQEALDRCVAHVLGERARLVEELPAVPGVEQVWPTQT 315 Query: 315 NMVLIRVADSA--KAYEGMKNRKVLVKNVSTMHPLLANCLRLTVGNAEDNAQMLAALQAS 372 N + RV + + G+ +R VL+K + HP L +CLR+TVG E+N + L AL + Sbjct: 316 NFLTFRVPQGSADAVHRGLLDRGVLIKRLHGSHPRLEDCLRVTVGRPEENNRFLEALAET 375 Query: 373 L 373 L Sbjct: 376 L 376 Lambda K H 0.321 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 380 Length adjustment: 30 Effective length of query: 343 Effective length of database: 350 Effective search space: 120050 Effective search space used: 120050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate WP_081432225.1 HHAL_RS10665 (histidinol-phosphate transaminase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.32569.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-98 314.6 0.0 4.1e-98 314.4 0.0 1.0 1 lcl|NCBI__GCF_000015585.1:WP_081432225.1 HHAL_RS10665 histidinol-phosphat Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015585.1:WP_081432225.1 HHAL_RS10665 histidinol-phosphate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 314.4 0.0 4.1e-98 4.1e-98 1 348 [. 28 374 .. 28 375 .. 0.96 Alignments for each domain: == domain 1 score: 314.4 bits; conditional E-value: 4.1e-98 TIGR01141 1 rekikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelk..klhrYpdpqalelkealaky 67 r+++++le+Yq + e ++ + +kL+++E+P++ + ++ ea+ e+++ +++rYpdp a +lk l++ lcl|NCBI__GCF_000015585.1:WP_081432225.1 28 RPQVQALEAYQVA--E-PG-KAIKLDAMESPWAWPGALEEAWLERMRsvSVNRYPDPAARRLKPLLREG 92 789*********4..3.33.48************************9999******************* PP TIGR01141 68 lgv.eeenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedlea 135 lgv e +++llgnGsdeli+l+ a++ +g++v+++ p+++mY+++a+ +gae++evpl++++ dl+a lcl|NCBI__GCF_000015585.1:WP_081432225.1 93 LGVpEGAELLLGNGSDELIQLIDLAVAGSGRTVMAPGPSFAMYRIIAEYTGAEYVEVPLDAEFGLDLAA 161 **626799******************************************************8888888 PP TIGR01141 136 vle.aakekvklvflasPnnPtGnllkreeiekvleevedalVVvDeAYieFseeasvlellaeypnlv 203 + e + + ++ +++la+PnnPtGn l+ + + ++++++ d+lVVvDeAY ++++ s+l+ + e+pn + lcl|NCBI__GCF_000015585.1:WP_081432225.1 162 TREaVSAYNPAVTYLAHPNNPTGNGLDLDAVAELVAQS-DGLVVVDEAYAPYADS-SFLPRVLEFPNCL 228 88758889*****************************7.9**************6.************* PP TIGR01141 204 vlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkkerer 272 vlrTlSK+ LAglRvG++i+++++i++lek+r pyn+ sla++ a a+++++ + ++v++v er+r lcl|NCBI__GCF_000015585.1:WP_081432225.1 229 VLRTLSKVG-LAGLRVGVLIGHPAWIDQLEKCRLPYNLGSLAQASAAFAVEHQEALDRCVAHVLGERAR 296 *******97.*********************************************************** PP TIGR01141 273 lleelkklegle.vyeSkaNFvlikvke.daeelleallekgiivRdlksaeglleeclRitvGtreen 339 l eel +++g+e v + ++NF++++v++ a+++ + ll++g++++ l+ ++ le+clR+tvG +een lcl|NCBI__GCF_000015585.1:WP_081432225.1 297 LVEELPAVPGVEqVWPTQTNFLTFRVPQgSADAVHRGLLDRGVLIKRLHGSHPRLEDCLRVTVGRPEEN 365 ************9***************99*************************************** PP TIGR01141 340 erllealke 348 +r+leal+e lcl|NCBI__GCF_000015585.1:WP_081432225.1 366 NRFLEALAE 374 *******98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (380 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.61 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory