Align Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 (uncharacterized)
to candidate WP_081437051.1 XAUT_RS13720 aspartate aminotransferase family protein
Query= curated2:O27392 (390 letters) >NCBI__GCF_000017645.1:WP_081437051.1 Length = 509 Score = 188 bits (478), Expect = 3e-52 Identities = 139/416 (33%), Positives = 212/416 (50%), Gaps = 55/416 (13%) Query: 24 VLSHGKGATVWDIEGNSYIDCFAGVAVNSIGHAHPKVALAICHQAQRLIHSSNIYYTREQ 83 V++ +G V+D EGN +D +G+ + +GH + AI Q +L + + + T Sbjct: 69 VITRAEGVYVFDSEGNRILDGMSGLWCSQVGHGRRAIVDAIAQQLHQLDYYNTFFKTTHP 128 Query: 84 --VELAKLLTAISPH--DRVFFANSGAEANEGAIKLARKFTG------KSEIIAAENSFH 133 ELA ++ ++P + VFF + G+EA + +++ R + KS I+ N +H Sbjct: 129 GAAELAAAISDVAPAHMNHVFFTSGGSEAVDTVLRMVRHYWAALGKPEKSIFISRRNGYH 188 Query: 134 GRTLATVTATGQKK-YSEPFRPLPEGFKHV--PY-----GDIG--------------AMA 171 G TL + G K +++ P+P G HV PY G++G A+ Sbjct: 189 GSTLGGASLGGMKPMHAQGGLPIP-GIIHVAQPYWWAEGGEMGREEFGLFAAREVARAID 247 Query: 172 DAVGDETAAIILEPVQGEGGVIIPPEGYLKDVQELARQNDVLLILDEVQTGFGRTGAMFA 231 +A + AA I EP+QG GGVIIPP Y +V+++ R+ DVLL+ DEV GFGRTG F Sbjct: 248 EAGPENVAAFIGEPIQGAGGVIIPPANYWPEVEKICRERDVLLVCDEVICGFGRTGRWFG 307 Query: 232 SQLFGVEPDITTVAKAMGGGY-PIGAVLANERVAMAF-EPG---DHGSTFGGNPWGCAAA 286 + GV+PD+ T AK + GY P+G V+ ++VA F E G +HG T+ G+P GCAAA Sbjct: 308 ADFMGVKPDLITFAKGITSGYFPLGGVIVGDKVAEGFIEHGGDFNHGFTYSGHPGGCAAA 367 Query: 287 IATIEVLMDEKLPERA-AKMGSYFLGR-LRQVLHGCDAVRDIRGVGLMIGIEIDGECAGV 344 +A + ++ +EKL ER +G Y R L+ H V + R VGL+ +E+ E A Sbjct: 368 LANLRIMHEEKLVERVRTDIGPYLQERWLKLAEH--PLVGEARMVGLIGALELTPEKASR 425 Query: 345 VDAAREMGVL------INCTAGKVIRIV-------PPLVIKKEEIDAAVDVLGHVI 387 A E G + + G V+R V PP + EE D V + V+ Sbjct: 426 AAFAAEEGTVGLICRDFSFREGLVMRAVRDGMILAPPFTLSHEEADELVAITWRVL 481 Lambda K H 0.320 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 505 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 390 Length of database: 509 Length adjustment: 32 Effective length of query: 358 Effective length of database: 477 Effective search space: 170766 Effective search space used: 170766 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory