Align Methionine synthase component, B12 binding and B12-binding cap domains (EC:2.1.1.13) (characterized)
to candidate WP_081662708.1 G579_RS16870 methionine synthase
Query= reanno::Phaeo:GFF1319 (233 letters) >NCBI__GCF_000423825.1:WP_081662708.1 Length = 849 Score = 113 bits (283), Expect = 1e-29 Identities = 62/181 (34%), Positives = 106/181 (58%), Gaps = 3/181 (1%) Query: 20 QQMFDDLYDGLKEEIEESVNILLERGWAPYKVLTEALVGGMTIVGADFRDGILFVPEVLL 79 +++ + DG K+ +E+ + LE+ + P +++ L+ GM +VG F G + +P VL Sbjct: 631 ERLTQRIVDGDKQGLEDDLKAALEQ-YPPLEIINTFLLDGMKVVGELFGSGQMQLPFVLQ 689 Query: 80 AANAMKGGMAILKPLLAETGAPRMGSMVIGTVKGDIHDIGKNLVSMMMEGAGFEVVDIGI 139 +A MK +A L+P + + G +V+ TVKGD+HDIGKNLV +++ G++VV++GI Sbjct: 690 SAETMKAAVAFLEPFMEKVEGEEKGILVLATVKGDVHDIGKNLVDIILTNNGYKVVNLGI 749 Query: 140 NNPVENYLEALEEHQPDILGMSALLTTTMPYMKVVIDTMIEQGKRDDYIVLVGGAPLNEE 199 P+++ ++A + +GMS LL + MK ++ M +G D VL+GGA L Sbjct: 750 KQPIDSIVQAACDCGAHAIGMSGLLVKSTVIMKENLEEMRRRGL--DIPVLLGGAALTRR 807 Query: 200 F 200 F Sbjct: 808 F 808 Lambda K H 0.318 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 470 Number of extensions: 25 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 849 Length adjustment: 32 Effective length of query: 201 Effective length of database: 817 Effective search space: 164217 Effective search space used: 164217 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory