Align N-acetyl-gamma-glutamyl-phosphate reductase; Short=AGPR; EC 1.2.1.38 (characterized, see rationale)
to candidate WP_083441685.1 NITAL_RS16980 N-acetyl-gamma-glutamyl-phosphate reductase
Query= uniprot:E4PLW0 (388 letters) >NCBI__GCF_000969705.1:WP_083441685.1 Length = 365 Score = 291 bits (746), Expect = 2e-83 Identities = 162/351 (46%), Positives = 213/351 (60%), Gaps = 16/351 (4%) Query: 46 KVGIVGGTGYTGVELLRILAVHPEVSVSCITSRSEAGMPVAEMYPNLRGHYDLAFSEPDV 105 ++GIVG +GY G ELLR+ A HP V+ + + S+AG P+ +++PNL G F +V Sbjct: 23 RLGIVGASGYGGAELLRLAATHPAFEVAVVAAHSQAGTPIVDLFPNLAG--TRVFDAIEV 80 Query: 106 NVLGACDLVFFATPHGVAMRMVPELMSAGVRVVDLSADFRLKDLDVWANWYGMAHESPEW 165 L CD+V ATPH VA+ + EL AGVRVVDLSA FRL +D +A WYG H+ P+ Sbjct: 81 GALAECDVVVLATPHDVALELGAELFDAGVRVVDLSAAFRLS-VDGFATWYGGTHDRPDL 139 Query: 166 AE-------KAVYGLPEVV-RDEIRNAQLVANPGCYPTAVQLGFLPLLEQGLVDPKRLIA 217 A AVYGLPE+ R+ +R A LVANPGCYPTA LG PL GL+ P ++ Sbjct: 140 ATGDAAADPAAVYGLPELGHREAVRGATLVANPGCYPTATLLGLAPLA--GLLQPGTIVV 197 Query: 218 DAKSGASGAGRQGKIGMLHGEIGESFKAYGASGHRHLPEIRQGLCGAAGGDVGVTFVPHL 277 DAKSG SGAGR K + + AYGA GHRH EI + L G G V+F PHL Sbjct: 198 DAKSGTSGAGRAAKDTLHFSHVHGDLSAYGAPGHRHTGEIERWLPGDLGA---VSFTPHL 254 Query: 278 IPMIRGIEATLYAELKNPADFDRLQALFEQRFDDEPFVDVMPFGSHPETRSVRGANQCRM 337 +PM RG+ AT YA L + D +Q + DEPFV V+ G P T+++ G+N C++ Sbjct: 255 VPMARGLLATCYATLADGVDAAAVQDALTTAYADEPFVHVLAPGRFPHTKALAGSNGCQL 314 Query: 338 ALHRQEQSNIVIVSSVIDNLVKGAAGQAVQNMNIMFGLKETMGLEAPALLP 388 + ++ V V+S IDNL KGAAGQA+QN N+M G++ET GL + P Sbjct: 315 SAVVDGRTGRVTVTSAIDNLGKGAAGQALQNANLMLGIEETAGLTTVGVYP 365 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 365 Length adjustment: 30 Effective length of query: 358 Effective length of database: 335 Effective search space: 119930 Effective search space used: 119930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_083441685.1 NITAL_RS16980 (N-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01850.hmm # target sequence database: /tmp/gapView.9046.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01850 [M=345] Accession: TIGR01850 Description: argC: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-116 375.4 0.0 1.7e-116 375.2 0.0 1.0 1 lcl|NCBI__GCF_000969705.1:WP_083441685.1 NITAL_RS16980 N-acetyl-gamma-glu Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000969705.1:WP_083441685.1 NITAL_RS16980 N-acetyl-gamma-glutamyl-phosphate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 375.2 0.0 1.7e-116 1.7e-116 2 345 .] 23 365 .] 22 365 .] 0.95 Alignments for each domain: == domain 1 score: 375.2 bits; conditional E-value: 1.7e-116 TIGR01850 2 kvaivGasGYtGaeLlrllakHpevevtklvssreagkklsevhphlkglvdlkleeleeeeileeadv 70 +++ivGasGY+GaeLlrl a+Hp++ev+ ++++++ag+++ +++p+l g+ ++++e+ +l+e+dv lcl|NCBI__GCF_000969705.1:WP_083441685.1 23 RLGIVGASGYGGAELLRLAATHPAFEVAVVAAHSQAGTPIVDLFPNLAGT--RVFDAIEVG-ALAECDV 88 689*************************9999999************997..578888886.4679*** PP TIGR01850 71 vflAlphgvsaelvpellekgvkvidlSadfRlkdaevYekwYgkkhekeelle.......eavYGlpE 132 v+lA+ph v+ el +el ++gv+v+dlSa+fRl+ + +++wYg +h++++l++ avYGlpE lcl|NCBI__GCF_000969705.1:WP_083441685.1 89 VVLATPHDVALELGAELFDAGVRVVDLSAAFRLS-VDGFATWYGGTHDRPDLATgdaaadpAAVYGLPE 156 **********************************.668************9875333333469****** PP TIGR01850 133 ln.reeikkaklianPGCyaTaalLalaPllkekliepksiivdaksGvSgAGrkasekslfaevnenl 200 l re++++a+l+anPGCy+Ta+lL+laPl+ +l++p +i+vdaksG+SgAGr+a+++ +f++v++ l lcl|NCBI__GCF_000969705.1:WP_083441685.1 157 LGhREAVRGATLVANPGCYPTATLLGLAPLA--GLLQPGTIVVDAKSGTSGAGRAAKDTLHFSHVHGDL 223 *77***************************9..999********************************* PP TIGR01850 201 kpYkvtkHrHtpEieqelsklaekkvkvsftphlvpmtrGilatiyaklkkelteeelrklyeevYede 269 ++Y + +HrHt Eie+ l ++ vsftphlvpm rG+lat+ya+l+++++++ ++++++++Y+de lcl|NCBI__GCF_000969705.1:WP_083441685.1 224 SAYGAPGHRHTGEIERWLP---GDLGAVSFTPHLVPMARGLLATCYATLADGVDAAAVQDALTTAYADE 289 ******************9...44445****************************************** PP TIGR01850 270 pfvrvlkegelPstkavlgsnfvdigvavdeetkrvvvvsaiDNLvKGaagqAvqnlNlmlgfdetegL 338 pfv+vl g++P+tka +gsn ++++ vd +t+rv+v+saiDNL KGaagqA+qn Nlmlg +et+gL lcl|NCBI__GCF_000969705.1:WP_083441685.1 290 PFVHVLAPGRFPHTKALAGSNGCQLSAVVDGRTGRVTVTSAIDNLGKGAAGQALQNANLMLGIEETAGL 358 ********************************************************************* PP TIGR01850 339 eklpllp 345 ++++++p lcl|NCBI__GCF_000969705.1:WP_083441685.1 359 TTVGVYP 365 *****98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (345 nodes) Target sequences: 1 (365 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.98 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory