Align succinyldiaminopimelate transaminase (EC 2.6.1.17) (characterized)
to candidate WP_083441868.1 NITAL_RS21545 hypothetical protein
Query= BRENDA::P9WPZ5 (397 letters) >NCBI__GCF_000969705.1:WP_083441868.1 Length = 394 Score = 344 bits (883), Expect = 2e-99 Identities = 190/387 (49%), Positives = 241/387 (62%), Gaps = 11/387 (2%) Query: 4 SRLRPYATTVFAEMSALATRIGAVNLGQGFPDEDGPPKMLQAAQDAIAGGVNQYPPGPGS 63 +RLR +T+VF+E+SALA + GA NLGQGFPD+ P ++ AA A+ G +QY PGPG Sbjct: 11 TRLRGLSTSVFSEISALAHQHGAANLGQGFPDDGPPEHVVAAAHAALDAGHHQYAPGPGI 70 Query: 64 APLRRAIAAQRRRHFGVDYDPETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYS 123 LRRAIA ++R G D ETEV VT GATEA+ AAVL L +PG EV++++P YDSY+ Sbjct: 71 PALRRAIADHQQRFHGQHVDAETEVTVTFGATEAVTAAVLALCDPGDEVIVLDPVYDSYT 130 Query: 124 PVVAMAGAHRVTVPLVP--DGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATEL 181 V+AMA A V VP+ P + RG+ LD D L A+TPRTR L++NSPHNPTG VL+A EL Sbjct: 131 AVIAMAAAAEVRVPIDPPTEERGWHLDLDRLAAAITPRTRLLLLNSPHNPTGLVLTADEL 190 Query: 182 AAIAEIAVAANLVVITDEVYEHLVFDHARHLPLAGFDGMAERTITISSAAKMFNCTGWKI 241 IA + V +L V+TDEVYEHLV D H+PLA GMAERT+T+SS K F+CTGWK+ Sbjct: 191 DRIASLCVDRDLTVVTDEVYEHLVHD-GSHVPLATRPGMAERTLTVSSLGKTFSCTGWKV 249 Query: 242 GWACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAWVAALRNSLRARRDRLAAG 301 GWA P L VRA KQ+LS+ GG P Q A AL ++D A + R + Sbjct: 250 GWAVAPPPLTEAVRAVKQFLSFAGGTPLQHAAVTALGSDDTTYAEVTAGNARRHALIVDR 309 Query: 302 LTEIGFAVHDSYGTYFLCADPRPLGYDDSTEFCAALPEKVGVAAIPMSAFCDPAAGQASQ 361 L + V S GTYF+ D LG+DD+ F PE+ GVA +P++AF S Sbjct: 310 LRDADVRVVPSAGTYFVTVDLASLGHDDADAFARRAPEEHGVAVVPIAAF--------SG 361 Query: 362 QADVWNHLVRFTFCKRDDTLDEAIRRL 388 D R CKR+D L I RL Sbjct: 362 TPDALRSWARLAACKREDVLVLGIDRL 388 Lambda K H 0.321 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 484 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 394 Length adjustment: 31 Effective length of query: 366 Effective length of database: 363 Effective search space: 132858 Effective search space used: 132858 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory