Align Histidinol dehydrogenase; HDH; EC 1.1.1.23 (characterized)
to candidate WP_083442240.1 NITAL_RS18765 histidinol dehydrogenase
Query= SwissProt::P9WNW9 (444 letters) >NCBI__GCF_000969705.1:WP_083442240.1 Length = 433 Score = 351 bits (900), Expect = e-101 Identities = 209/427 (48%), Positives = 266/427 (62%), Gaps = 17/427 (3%) Query: 27 LPRGGADVEAVLPTVRPIVAAVAERGAEAALDFGASFDGVRPHA---IRVPDAALDAALA 83 +PR D+ A V +A V RG A D A FD A + VPD LDAAL Sbjct: 1 MPRPRVDLAAAREGVDATLADVKARGDAALRDLTARFDATEFGADEPLVVPDEVLDAALL 60 Query: 84 GLDCDVCEALQVMVERTRAVHSGQRRTDVTTTLGPGATVTERWVPVERVGLYVPGGNAVY 143 LD ++ A++ ++ R H + D GA + + P+ER G+YVPGG AVY Sbjct: 61 DLDPELRAAIERAADQVRWFHERAKPEDWEDERD-GARMGVWFRPIERAGVYVPGGKAVY 119 Query: 144 PSSVVMNVVPAQAAGVDSLVVASPP-----QAQWDGMPHPTILAAARLLGVDEVWAVGGA 198 PS+V+M VVPAQ AGVD +V+ +PP + DG P+ TILAAARLLGVD V VGGA Sbjct: 120 PSTVIMTVVPAQVAGVDQIVLCTPPTGTGPDGERDGWPNRTILAAARLLGVDRVVRVGGA 179 Query: 199 QAVALLAYGGTDTDGAALTPVDMITGPGNIYVTAAKR--LCRSRVGIDAEAGPTEIAILA 256 QAVA +AYG TD+ A D + GPGN+YV+ AK+ + +G D AGPTE+ I+A Sbjct: 180 QAVAAMAYG-TDSVPAC----DKVVGPGNLYVSLAKQRLVAEGVIGTDGYAGPTEVVIVA 234 Query: 257 DHTADPVHVAADLISQAEHDELAASVLVTPSEDLADATDAELAGQLQTTVHRERVTAALT 316 D TADP VAADL++QAEHDELA ++L+T DL +A L ++ HRERV AAL Sbjct: 235 DGTADPRVVAADLVAQAEHDELATAMLITHDADLVAPVEAALEVEVTRAHHRERVEAALA 294 Query: 317 GRQSAIVLVDDVDAAVLVVNAYAAEHLEIQTADAPQVASRIRSAGAIFVGPWSPVSLGDY 376 G Q + LVDD+D AV V A+AAEHLE+QT DA VA RIR AG F+G +PVSLGDY Sbjct: 295 G-QGTVALVDDIDQAVQVAEAFAAEHLEVQTVDARAVAERIRYAGTTFIGGPTPVSLGDY 353 Query: 377 CAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVEYTEAALKDVSGHVITLATAEDLPAHGE 436 AG NH LPT+G AR + GL+ +FL ++ VEY + AL+ ++ V TLA +EDLPAH Sbjct: 354 AAGPNHTLPTSGTARFAGGLTTSSFLVPVNFVEYDQVALEGLAASVRTLAASEDLPAHAR 413 Query: 437 AVRRRFE 443 AV R E Sbjct: 414 AVDVRLE 420 Lambda K H 0.317 0.132 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 492 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 433 Length adjustment: 32 Effective length of query: 412 Effective length of database: 401 Effective search space: 165212 Effective search space used: 165212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_083442240.1 NITAL_RS18765 (histidinol dehydrogenase)
to HMM TIGR00069 (hisD: histidinol dehydrogenase (EC 1.1.1.23))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00069.hmm # target sequence database: /tmp/gapView.27772.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00069 [M=393] Accession: TIGR00069 Description: hisD: histidinol dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-142 459.7 1.2 5.6e-142 459.5 1.2 1.0 1 lcl|NCBI__GCF_000969705.1:WP_083442240.1 NITAL_RS18765 histidinol dehydro Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000969705.1:WP_083442240.1 NITAL_RS18765 histidinol dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 459.5 1.2 5.6e-142 5.6e-142 2 393 .] 16 418 .. 15 418 .. 0.96 Alignments for each domain: == domain 1 score: 459.5 bits; conditional E-value: 5.6e-142 TIGR00069 2 keiiedvrkeGdeAlleytekfdkv...kleslrvseeeleealeavdeelkealelaaeniekfhekq 67 + ++dv+++Gd+Al+++t +fd + e l v++e l++al +d+el++a+e+aa++++ fhe+ lcl|NCBI__GCF_000969705.1:WP_083442240.1 16 DATLADVKARGDAALRDLTARFDATefgADEPLVVPDEVLDAALLDLDPELRAAIERAADQVRWFHERA 84 56789******************997777789************************************* PP TIGR00069 68 lpesveveteegvllgqkvrplervglYvPgGkaaypStvlmtavpAkvAgvkeivvvtPp.......k 129 +pe++e ++++g +g +rp+er+g+YvPgGka ypStv+mt+vpA+vAgv++iv++tPp + lcl|NCBI__GCF_000969705.1:WP_083442240.1 85 KPEDWE-DERDGARMGVWFRPIERAGVYVPGGKAVYPSTVIMTVVPAQVAGVDQIVLCTPPtgtgpdgE 152 ****96.5689*************************************************955433322 PP TIGR00069 130 kdgkvnpavlaaakllgvdevykvGGaqaiaalayGtetvpkvdkivGPGniyVtaAKklvf..gevgi 196 +dg n+++laaa+llgvd+v++vGGaqa+aa+ayGt++vp++dk+vGPGn yV AK+ ++ g +g lcl|NCBI__GCF_000969705.1:WP_083442240.1 153 RDGWPNRTILAAARLLGVDRVVRVGGAQAVAAMAYGTDSVPACDKVVGPGNLYVSLAKQRLVaeGVIGT 221 47789*****************************************************98876779*** PP TIGR00069 197 dmiaGPsEvlviadesanpelvaaDllsqaEHdedaqailvttseelaekveeeveeqleelerkeiae 265 d aGP+Ev+++ad +a+p++vaaDl++qaEHde a+a+l+t++++l++ ve+++e ++++++++e +e lcl|NCBI__GCF_000969705.1:WP_083442240.1 222 DGYAGPTEVVIVADGTADPRVVAADLVAQAEHDELATAMLITHDADLVAPVEAALEVEVTRAHHRERVE 290 ********************************************************************* PP TIGR00069 266 kslekngaiilvddleealelsneyApEHLelqtkdpeellkkiknaGsvflGeytpealgdyvaGpnh 334 ++l+ +g++ lvdd+++a+++++++A+EHLe+qt d+++++++i+ aG+ f+G tp++lgdy+aGpnh lcl|NCBI__GCF_000969705.1:WP_083442240.1 291 AALAGQGTVALVDDIDQAVQVAEAFAAEHLEVQTVDARAVAERIRYAGTTFIGGPTPVSLGDYAAGPNH 359 ********************************************************************* PP TIGR00069 335 vLPTsgtArfasglsvedFlkrisvqelskealeelaeaveklaeaEgLeaHaeavevR 393 +LPTsgtArfa+gl++++Fl ++++e+++ ale la +v++la+ E+L aHa+av+vR lcl|NCBI__GCF_000969705.1:WP_083442240.1 360 TLPTSGTARFAGGLTTSSFLVPVNFVEYDQVALEGLAASVRTLAASEDLPAHARAVDVR 418 *********************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (393 nodes) Target sequences: 1 (433 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.40 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory