Align acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17] (characterized)
to candidate WP_083509450.1 APY04_RS02685 aspartate aminotransferase family protein
Query= reanno::azobra:AZOBR_RS19025 (389 letters) >NCBI__GCF_001541235.1:WP_083509450.1 Length = 388 Score = 432 bits (1110), Expect = e-125 Identities = 219/378 (57%), Positives = 272/378 (71%) Query: 6 MPTYARADIVFERGEGPYLYATDGRRFLDFAAGVAVNVLGHANPYLVEALTAQAHKLWHT 65 M TYAR ++VFERGEG +L DG R+LD +GVAVNVLGHA+P LV AL QA KLWHT Sbjct: 1 MGTYARQNLVFERGEGVWLITVDGDRYLDLGSGVAVNVLGHAHPRLVAALNEQASKLWHT 60 Query: 66 SNLFRVAGQESLAKRLTEATFADTVFFTNSGAEAWECGAKLIRKYHYEKGDKARTRIITF 125 SNL+RV GQE LA+RL TFAD VFF NSGAEA E K R+YH+ G+ R RIITF Sbjct: 61 SNLYRVEGQERLAERLVATTFADKVFFCNSGAEACEAAIKAARRYHFAGGEPERWRIITF 120 Query: 126 EQAFHGRTLAAVSAAQQEKLIKGFGPLLDGFDLVPFGDLEAVRNAVTDETAGICLEPIQG 185 AFHGRTLA ++A + ++GFG + GFD VPFGDL A A++ ETA I +EP+QG Sbjct: 121 NGAFHGRTLATIAAGGNPRYLEGFGTPVAGFDQVPFGDLTATEKAISPETAAIMIEPVQG 180 Query: 186 EGGIRAGSVEFLRGLREICDEHGLLLFLDEIQCGMGRTGKLFAHEWAGITPDVMAVAKGI 245 EGG+ S EF++GLR +CD +GLLL LDE+Q G+GR+G+LF++E AGITPD+MA+AKGI Sbjct: 181 EGGVNVASAEFMQGLRALCDANGLLLVLDEVQSGIGRSGQLFSYELAGITPDLMAIAKGI 240 Query: 246 GGGFPLGACLATEKAASGMTAGTHGSTYGGNPLATAVGNAVLDKVLEPGFLDHVQRIGGL 305 GGGFPLGA LATE AA G+ GTHGST+GGNPLATA+G VL+ V E GFL+ V+R Sbjct: 241 GGGFPLGALLATENAARGLVPGTHGSTFGGNPLATAIGLEVLNAVQEEGFLESVRRKSLH 300 Query: 306 LQDRLAGLVAENPAVFKGVRGKGLMLGLACGPAVGDVVVALRANGLLSVPAGDNVVRLLP 365 ++ LA + P + + VRG+GL++GL D+V A R LL V A DNVVRLLP Sbjct: 301 IKQSLAAISDNYPGIVQEVRGQGLLVGLKLSVPPADLVAAAREEHLLLVGASDNVVRLLP 360 Query: 366 PLNIGEAEVEEAVAILAK 383 PLNI + E+ EA+ L + Sbjct: 361 PLNITDEEIAEAMQRLER 378 Lambda K H 0.321 0.139 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 388 Length adjustment: 30 Effective length of query: 359 Effective length of database: 358 Effective search space: 128522 Effective search space used: 128522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory