Align aspartate-prephenate aminotransferase (EC 2.6.1.78) (characterized)
to candidate WP_083509522.1 APY04_RS05760 1-aminocyclopropane-1-carboxylate deaminase
Query= BRENDA::Q56232 (385 letters) >NCBI__GCF_001541235.1:WP_083509522.1 Length = 413 Score = 179 bits (453), Expect = 2e-49 Identities = 127/368 (34%), Positives = 179/368 (48%), Gaps = 20/368 (5%) Query: 23 ALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFR 82 ALE G ++ + G+P P ++ A RAL Y G LR +A + Sbjct: 44 ALEAENAGRHIIHMEVGQPGTPAPRVARDVAARALQNDTLGYTMALGNDALRARIARHYA 103 Query: 83 RENGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEV 142 ++GL+V PE VT G A F ++ D GD V + SP + Y ++ G V + Sbjct: 104 DQHGLNVAPERIAVTAGSSAAFVLTFLSLFDAGDTVALPSPGYPCYRHILSALGQRSVLL 163 Query: 143 ETLPEEGFVPDPERVRRAIT-PRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLV 201 ET P ++PDP+ V RAIT K L++ SP NPTG + +E L AL + +H + Sbjct: 164 ETGPSNDWMPDPDDVLRAITRDGIKGLLIASPANPTGTMISRERLRALTDVCQQHGVRFI 223 Query: 202 SDEIYEHLLYEGEHFSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSS 261 SDEIY L Y + T+ +N +K F+MTGWRIG+ P+ +I+A+ ++ Sbjct: 224 SDEIYHGLTYT-RPADTALACSDDTIVINSFSKYFSMTGWRIGWMVVPQRLIRAVERLTQ 282 Query: 262 QSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPS-GA 320 SP +IAQ A L A +R +E R Y R+LLL L G P+ GA Sbjct: 283 NLYISPPSIAQAAALGAFD----ARVELEANRGVYAANRELLLAELPKAGFTQFAPADGA 338 Query: 321 FYV-------LMDTSPIAPDEVRAAERLL-EAGVAVVPGTDFAA---FGHVRLSYATSEE 369 FY+ L DT P D A LL EAGVA+ PG DF A +R SYA + Sbjct: 339 FYLYCNVGEFLRDTGP--QDAAALARTLLDEAGVALTPGNDFDAQRGGQFLRFSYAGTTA 396 Query: 370 NLRKALER 377 ++ +A R Sbjct: 397 DMAEAARR 404 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 413 Length adjustment: 31 Effective length of query: 354 Effective length of database: 382 Effective search space: 135228 Effective search space used: 135228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory