Align Cyclohexadienyl dehydrogenase and ADH prephenate dehydrogenase (characterized, see rationale)
to candidate WP_083509879.1 APY04_RS16085 cyclohexadienyl dehydrogenase
Query= uniprot:Q92MG1 (307 letters) >NCBI__GCF_001541235.1:WP_083509879.1 Length = 331 Score = 387 bits (993), Expect = e-112 Identities = 195/297 (65%), Positives = 228/297 (76%) Query: 5 FQTIALIGIGLIGSSIARDIREKQLAGTIVVTTRSEATLKRAGELGLGDRYTLSAAEAVE 64 F+ +ALIGIGLIGSSI+ +R LA IV + R+ ATL+ + LGL D+ SA EAVE Sbjct: 2 FKRVALIGIGLIGSSISHAMRRGGLAAEIVGSARTPATLETSLRLGLIDKGYASATEAVE 61 Query: 65 GADLVVVSVPVGASGAVAAEIAAHLKPGAIVTDVGSTKGSVIAQMAPHLPKDVHFVPGHP 124 GADLV++SVPVGA G + AEIA HL GAI+TDVGS K V+ MAPH+P VHFVPGHP Sbjct: 62 GADLVILSVPVGACGPITAEIAPHLARGAILTDVGSVKAQVVRDMAPHVPAGVHFVPGHP 121 Query: 125 IAGTEHSGPDAGFAGLFRGRWCILTPPAGTDEEAVARLRLFWETLGSMVDEMDPKHHDKV 184 IAGTE SGP+AGFA LF GRW ILTP D+ AV +LR+FWE LG+ V+ MDP HHD V Sbjct: 122 IAGTEQSGPEAGFAELFDGRWTILTPTPDVDDAAVEKLRMFWEALGAKVEVMDPSHHDMV 181 Query: 185 LAIVSHLPHIIAYNIVGTADDLETVTESEVIKYSASGFRDFTRLAASDPTMWRDVCLHNK 244 LAI SHLPH+IA+NIV TA+DL VT+ EVIK+SA GFRDFTR+AASDPTMWRD+ L N+ Sbjct: 182 LAITSHLPHLIAFNIVNTAEDLGRVTDKEVIKFSAGGFRDFTRIAASDPTMWRDIFLGNR 241 Query: 245 DAILEMLARFSEDLASLQRAIRWGDGDKLFDLFTRTRAIRRSIVQAGQDTAMPDFGR 301 D ++EML RFSEDL L+RAI GDGD LF FT RAIRR IV AGQDT+ PDFGR Sbjct: 242 DGVMEMLRRFSEDLDELKRAIEAGDGDTLFRRFTEARAIRRGIVAAGQDTSAPDFGR 298 Lambda K H 0.320 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 331 Length adjustment: 28 Effective length of query: 279 Effective length of database: 303 Effective search space: 84537 Effective search space used: 84537 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory