Align 3-dehydroquinate dehydratase (EC 4.2.1.10) (characterized)
to candidate WP_083510407.1 AU252_RS23270 type II 3-dehydroquinate dehydratase
Query= BRENDA::N1V364 (155 letters) >NCBI__GCF_001484605.1:WP_083510407.1 Length = 314 Score = 211 bits (537), Expect = 9e-60 Identities = 100/152 (65%), Positives = 121/152 (79%) Query: 4 MSEHSTGSSTRKLLVLNGPNLNLLGTREPQIYGSDTLEDAETLAARAAEAHGLAVECLQS 63 M+E +T + +LV+NGPNLNLLGTREP+ YG+ TL D E LAA A+AHG VEC+QS Sbjct: 163 MTEATTAAGRGTILVINGPNLNLLGTREPEKYGTSTLADVEQLAATTAQAHGFNVECVQS 222 Query: 64 NHEGVLIDAIHAARGTAAGIVINPGGYTHTSVALRDALSGVDLPVVEVHISNIHRREEFR 123 NHEGVL+D IHAARGTA GIV+N G +THTSVALRDAL+ V LP VEVHI+N+H+REEFR Sbjct: 223 NHEGVLLDVIHAARGTAVGIVLNAGAFTHTSVALRDALAAVQLPAVEVHITNVHQREEFR 282 Query: 124 HHSYISGIAVAVIAGAGISGYKFAVDLLASRL 155 HHS++S + AVI GAG+ GYK A+D LA L Sbjct: 283 HHSFLSPVCAAVIVGAGVFGYKLAIDYLAEAL 314 Lambda K H 0.317 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 117 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 155 Length of database: 314 Length adjustment: 22 Effective length of query: 133 Effective length of database: 292 Effective search space: 38836 Effective search space used: 38836 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 45 (21.9 bits)
Align candidate WP_083510407.1 AU252_RS23270 (type II 3-dehydroquinate dehydratase)
to HMM TIGR01088 (aroQ: 3-dehydroquinate dehydratase, type II (EC 4.2.1.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01088.hmm # target sequence database: /tmp/gapView.2484.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01088 [M=141] Accession: TIGR01088 Description: aroQ: 3-dehydroquinate dehydratase, type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-62 194.4 0.3 4.8e-62 193.9 0.3 1.2 1 lcl|NCBI__GCF_001484605.1:WP_083510407.1 AU252_RS23270 type II 3-dehydroq Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001484605.1:WP_083510407.1 AU252_RS23270 type II 3-dehydroquinate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 193.9 0.3 4.8e-62 4.8e-62 2 140 .. 175 313 .. 174 314 .] 0.99 Alignments for each domain: == domain 1 score: 193.9 bits; conditional E-value: 4.8e-62 TIGR01088 2 ilvlnGPnlnlLGkrepkvyGsltleeieelleeaakelevevevfqsnsegelidkihealeqvdgiv 70 ilv+nGPnlnlLG+rep+ yG+ tl ++e+l ++a++++ +ve++qsn+eg l+d ih a +++ giv lcl|NCBI__GCF_001484605.1:WP_083510407.1 175 ILVINGPNLNLLGTREPEKYGTSTLADVEQLAATTAQAHGFNVECVQSNHEGVLLDVIHAARGTAVGIV 243 89******************************************************************* PP TIGR01088 71 inpaalthtsvalrDalaavslPvvevhlsnvhareefrkksvlaevakGvivGlGakgyklalealve 139 +n++a+thtsvalrDalaav+lP vevh++nvh+reefr++s+l++v+ vivG G+ gykla+ +l+e lcl|NCBI__GCF_001484605.1:WP_083510407.1 244 LNAGAFTHTSVALRDALAAVQLPAVEVHITNVHQREEFRHHSFLSPVCAAVIVGAGVFGYKLAIDYLAE 312 ******************************************************************998 PP TIGR01088 140 a 140 a lcl|NCBI__GCF_001484605.1:WP_083510407.1 313 A 313 6 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (141 nodes) Target sequences: 1 (314 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 13.17 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory