Align 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8) (characterized)
to candidate WP_083536517.1 ACG33_RS06815 4-hydroxy-tetrahydrodipicolinate reductase
Query= BRENDA::Q9K1F1 (269 letters) >NCBI__GCF_001579945.1:WP_083536517.1 Length = 264 Score = 226 bits (575), Expect = 5e-64 Identities = 126/262 (48%), Positives = 164/262 (62%), Gaps = 2/262 (0%) Query: 6 IAIAGANGRMGRVLVEAVNNHPDTVLSGALEHSGSEALGLDAGYAV-GLKTGIAISDDVD 64 +A+ G +GRMGR L+ A++ LSGA S S +G+DAG A G G+A+ D Sbjct: 1 MAVLGVSGRMGRALLLAMDEAGGIRLSGASASSDSRWVGMDAGAAAQGAARGVAVLADPA 60 Query: 65 AVLAQSDVLIDFTRPEPTLKHLQKCVEKQVNIIIGTTGFDDTGKAAIHTAAEKTGIVFAA 124 + + + V IDFT P+ T +L CV + ++IGTTG + I AA+ +V A Sbjct: 61 SAIQGAAVAIDFTLPQATGANLDACVAARCPLVIGTTGHASEIRDRIVRAADHIPLVMAP 120 Query: 125 NFSVGVNLTFHILDTVARVLNEGYDIEIIEGHHRHKVDAPSGTALRMGEVIAGALGRDLK 184 N SVGVNL +++ AR L+E YDIEI E HHR K DAPSGTAL + A G +L+ Sbjct: 121 NMSVGVNLLLELVEQAARQLDERYDIEIFEAHHRDKKDAPSGTALGLAAAAAAGRGVELE 180 Query: 185 QCAVYGREGHTGPRDPSTIGFATVRAGDIVGDHTALFATDGERVEITHKASSRMTFAAGA 244 Q A YGR G TG R P IGF+ R GDIVG+HT FA GER+E+TH+AS R+ FA GA Sbjct: 181 QVAEYGRHGLTGARRPGNIGFSVFRGGDIVGEHTVSFAGIGERIELTHRASDRLAFARGA 240 Query: 245 VRAAVWVNGK-TGLYDMQDVLG 265 VRAA W+ G+ +GLY M+DVLG Sbjct: 241 VRAARWLIGRPSGLYSMRDVLG 262 Lambda K H 0.318 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 269 Length of database: 264 Length adjustment: 25 Effective length of query: 244 Effective length of database: 239 Effective search space: 58316 Effective search space used: 58316 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate WP_083536517.1 ACG33_RS06815 (4-hydroxy-tetrahydrodipicolinate reductase)
to HMM TIGR00036 (dapB: 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00036.hmm # target sequence database: /tmp/gapView.29560.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00036 [M=270] Accession: TIGR00036 Description: dapB: 4-hydroxy-tetrahydrodipicolinate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-78 249.7 0.1 2.1e-78 249.5 0.1 1.0 1 lcl|NCBI__GCF_001579945.1:WP_083536517.1 ACG33_RS06815 4-hydroxy-tetrahyd Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001579945.1:WP_083536517.1 ACG33_RS06815 4-hydroxy-tetrahydrodipicolinate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 249.5 0.1 2.1e-78 2.1e-78 5 270 .] 2 262 .. 1 262 [. 0.98 Alignments for each domain: == domain 1 score: 249.5 bits; conditional E-value: 2.1e-78 TIGR00036 5 avaGaaGrmGrevikavkeaedlelvaalerkgsskqgkDiGelagigkvgvpveddleavkvlaekka 73 av G +GrmGr ++ a+ ea +++l++a +s +g D+G a+ + gv+v +d ++ + a lcl|NCBI__GCF_001579945.1:WP_083536517.1 2 AVLGVSGRMGRALLLAMDEAGGIRLSGASASSDSRWVGMDAGAAAQGAARGVAVLADPASA----IQGA 66 899*****************************************************99988....7899 PP TIGR00036 74 dvliDfttpeavlenvkialekgvrlVvGTTGfseedlkelkdlaekkgvalviapNfaiGvnlllkll 142 v iDft+p+a+ n+ +++++ lV+GTTG e + ++ +a++ ++lv+apN+++Gvnlll l+ lcl|NCBI__GCF_001579945.1:WP_083536517.1 67 AVAIDFTLPQATGANLDACVAARCPLVIGTTGHASEIRDRIVRAADH--IPLVMAPNMSVGVNLLLELV 133 9**********************************************..******************** PP TIGR00036 143 ekaakvledv.DiEiiElHHrhKkDaPSGTAlklaeiiakargkdlkeaaveeregltGerkkeeiGia 210 e+aa+ l++ DiEi E+HHr KkDaPSGTAl la + a+ rg +l+++a ++r+gltG+r +iG++ lcl|NCBI__GCF_001579945.1:WP_083536517.1 134 EQAARQLDERyDIEIFEAHHRDKKDAPSGTALGLAAAAAAGRGVELEQVAEYGRHGLTGARRPGNIGFS 202 *******9866********************************************************** PP TIGR00036 211 avRggdvvgehtvlFasdGerleitHkassRaafakGvvrairwledkeekvydledvld 270 Rggd+vgehtv Fa++Ger+e+tH+as+R afa+G+vra+rwl +++y ++dvl+ lcl|NCBI__GCF_001579945.1:WP_083536517.1 203 VFRGGDIVGEHTVSFAGIGERIELTHRASDRLAFARGAVRAARWLIGRPSGLYSMRDVLG 262 **********************************************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (264 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 9.14 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory