Align Arginine biosynthesis bifunctional protein ArgJ; EC 2.3.1.35; EC 2.3.1.1 (characterized)
to candidate WP_083762353.1 CPAR_RS05050 bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ
Query= SwissProt::Q07908 (410 letters) >NCBI__GCF_000020505.1:WP_083762353.1 Length = 404 Score = 308 bits (789), Expect = 2e-88 Identities = 178/398 (44%), Positives = 237/398 (59%), Gaps = 3/398 (0%) Query: 14 ADGTVVTPEGFQAAGVNAGLRYSKNDLGVILCDVPASAAAVYTQSHFQAAPLKVTQASLA 73 A G PEGF +G+N G++ ++ DL ++LCD AS A+V+T + AAP+++++A+L+ Sbjct: 9 ASGDTFWPEGFTLSGINCGIKPTRKDLMLLLCDQLASTASVFTTNLCCAAPVELSKAALS 68 Query: 74 VEQ-KLQAVIVNRPCANACTGAQGLKDAYEMRELCAKQFGLALHHVAVASTGVIGEYLPM 132 K++AVI N ANA TGA+G+K+A M E A FG+ V VASTGVIG+ LP+ Sbjct: 69 ASNGKMRAVICNSGNANAATGAEGMKNAQRMAEATAAAFGVDAGEVLVASTGVIGQTLPV 128 Query: 133 EKIRAGIKQLVPGVTMADAEAFQTAILTTDTVMKRACYQTTIDGKTVTVGGAAKGSGMIH 192 +KI A + L A+ AI+TTDT K + T + G AKGSGMI Sbjct: 129 DKIDAAMPALKAASGTANWAEAAEAIMTTDTFPKAFAVDVKLSSGTTRIAGIAKGSGMIC 188 Query: 193 PNMATMLAFITTDANVSSPVLHAALRSITDVSFNQITVDGDTSTNDMVVVMASGLAGNDE 252 PNMATMLAF+ TD ++ +L L + VSFN ITVDGDTSTNDM +MASG E Sbjct: 189 PNMATMLAFLGTDVSIEPALLQELLSAANMVSFNAITVDGDTSTNDMAAIMASG--KGPE 246 Query: 253 LTPDHPDWENFYEALRKTCEDLAKQIAKDGEGATKLIEVRVRGAKTDEEAKKIAKQIVGS 312 + D + F EALR LA+ I DGEGATK +E+RV GAK+D EA+ A + S Sbjct: 247 VLRGTEDAKLFGEALRSVMTMLAQLIIVDGEGATKFVELRVTGAKSDAEARMAAMTVANS 306 Query: 313 NLVKTAVYGADANWGRIIGAIGYSDAEVNPDNVDVAIGPMVMLKGSEPQPFSEEEAAAYL 372 LVKTA++G DANWGRII A G S A + + V +LK FSEE A + Sbjct: 307 PLVKTAIHGEDANWGRIIAAAGRSGASFIQEELSVYFDDEPILKPGLDANFSEERAKEVM 366 Query: 373 QQETVVIEVDLHIGDGVGVAWGCDLTYDYVKINASYRT 410 QQ+ I + L G G W CDL++ Y++IN SYR+ Sbjct: 367 QQKEFTITLSLGNGPGAATVWTCDLSHGYIEINGSYRS 404 Lambda K H 0.316 0.130 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 408 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 404 Length adjustment: 31 Effective length of query: 379 Effective length of database: 373 Effective search space: 141367 Effective search space used: 141367 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory