Align branched-chain-amino-acid transaminase (EC 2.6.1.42); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate WP_083765180.1 HM1_RS06865 branched-chain-amino-acid transaminase
Query= BRENDA::P54691 (305 letters) >NCBI__GCF_000019165.1:WP_083765180.1 Length = 362 Score = 128 bits (321), Expect = 2e-34 Identities = 94/279 (33%), Positives = 147/279 (52%), Gaps = 25/279 (8%) Query: 7 IAYFEDKFVPFEDAKISVATHALHYGTAAFGGLRGIPDPEDPGTILLFRLDRHGDRLSKS 66 I Y + FVP E A+ISV H YG F G+R +F+LD H DRL S Sbjct: 76 IIYLDGCFVPEEQARISVFDHGFLYGDGIFEGIRAYNGR-------VFKLDAHIDRLYDS 128 Query: 67 AKFLHYDISAEK--IKEVIVDFVKKNQPDKSFYIRPLVYSSG---LGIAPR------LHN 115 AK + I K + +V+++ +++N + YIR LV S G LG+ PR + Sbjct: 129 AKAIQLAIPMGKGEMVDVVLETLRRNHL-RDAYIR-LVVSRGKGDLGLDPRKCPGATVMC 186 Query: 116 LEKDFLVYGLEMGDYLAADGVSCRISSWYRQEDRSFPLRGKISAAYITSALAKTEAVESG 175 + +Y E + G+ + R + R K S Y+ + LAK EA ++G Sbjct: 187 IAAGITLYPPEFYE----KGLEVVTVATRRNVPEALNPRIK-SLNYLNNILAKLEAAKAG 241 Query: 176 FDEAILMNSQGKVCEATGMNVFMVRNGQIVTPGNEQDILEGITRDSILTIAADLGIPTCQ 235 EAI++N +G V E TG N+F+++ +++TP ILEGITR++++ +A + GIP + Sbjct: 242 VLEAIMLNQEGYVAECTGDNIFIIKQRRLITPPVHVGILEGITRNTVMDLAREKGIPVVE 301 Query: 236 RPIDKSELMIADEVFLSGTAAKITPVKRIENFTLGGDRP 274 + ++ ADEVFL+GTAA++ PV ++ T+G P Sbjct: 302 AVFTRFDVYTADEVFLTGTAAEVIPVVTVDGRTIGEGVP 340 Lambda K H 0.320 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 305 Length of database: 362 Length adjustment: 28 Effective length of query: 277 Effective length of database: 334 Effective search space: 92518 Effective search space used: 92518 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory