Align anthranilate phosphoribosyltransferase (EC 2.4.2.18) (characterized)
to candidate WP_083767274.1 MVAN_RS31235 anthranilate phosphoribosyltransferase
Query= BRENDA::A5U4M0 (370 letters) >NCBI__GCF_000015305.1:WP_083767274.1 Length = 342 Score = 541 bits (1395), Expect = e-159 Identities = 274/341 (80%), Positives = 300/341 (87%) Query: 30 ILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSH 89 ILGRLT + LA GQ AWAMDQIMTG A PAQIAAFAV+M MK PT+ EV ELA +ML H Sbjct: 2 ILGRLTTGQGLAPGQTAWAMDQIMTGTATPAQIAAFAVSMKMKRPTSAEVTELADIMLKH 61 Query: 90 AHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGAD 149 A +P D + VD+VGTGGDG NTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGAD Sbjct: 62 ARRVPTDVIGTATVDIVGTGGDGANTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGAD 121 Query: 150 TLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLT 209 TLEALG+RIDLGPD VAR +AEVGIGF FAP+FHPSYRHA AVRREIGVPTVFNLLGPLT Sbjct: 122 TLEALGLRIDLGPDEVARCVAEVGIGFAFAPQFHPSYRHAGAVRREIGVPTVFNLLGPLT 181 Query: 210 NPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSV 269 NPA PRAGLIGCA+ADLAEVMAGVFA R SSVLVVHGDDGLDELTTTTTSTIWRV AG+V Sbjct: 182 NPASPRAGLIGCAWADLAEVMAGVFATRGSSVLVVHGDDGLDELTTTTTSTIWRVQAGTV 241 Query: 270 DKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAG 329 ++LTFDPA FGFARA + +L GGDA++NAA+ RAVLGGA+GPVRDAVVLNAAGA+VAHAG Sbjct: 242 ERLTFDPAAFGFARAHVSELTGGDAESNAASARAVLGGAKGPVRDAVVLNAAGALVAHAG 301 Query: 330 LSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI 370 LSS A+W+PAWE GL RA AID+GAAEQLLARWVRF +Q+ Sbjct: 302 LSSDAKWVPAWESGLARAKDAIDSGAAEQLLARWVRFTQQL 342 Lambda K H 0.318 0.132 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 342 Length adjustment: 29 Effective length of query: 341 Effective length of database: 313 Effective search space: 106733 Effective search space used: 106733 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_083767274.1 MVAN_RS31235 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.13372.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-119 382.5 0.1 1.1e-118 382.3 0.1 1.0 1 lcl|NCBI__GCF_000015305.1:WP_083767274.1 MVAN_RS31235 anthranilate phosph Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015305.1:WP_083767274.1 MVAN_RS31235 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 382.3 0.1 1.1e-118 1.1e-118 2 329 .. 4 337 .. 3 338 .. 0.97 Alignments for each domain: == domain 1 score: 382.3 bits; conditional E-value: 1.1e-118 TIGR01245 2 eklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkveke.ese 69 +l++++ L+ ++ +++m++im+g a++aqiaA+ v +++k t e+++la +++++a++v+++ + lcl|NCBI__GCF_000015305.1:WP_083767274.1 4 GRLTTGQGLAPGQTAWAMDQIMTGTATPAQIAAFAVSMKMKRPTSAEVTELADIMLKHARRVPTDvIGT 72 5789999*********************************************************97789 PP TIGR01245 70 elvDivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsl 138 vDivGTGGDg++t+N+ST++a+v+aaaGv+v+KhGnr++ss sG+aD+Lealg++++l p++var++ lcl|NCBI__GCF_000015305.1:WP_083767274.1 73 ATVDIVGTGGDGANTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGLRIDLGPDEVARCV 141 99******************************************************************* PP TIGR01245 139 eevgigFlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlg 207 +evgigF fAP++hp+++++ +vR+e+gv+tvfNlLGPL+nPa++++ ++G++ +dl+ev+a v+ + g lcl|NCBI__GCF_000015305.1:WP_083767274.1 142 AEVGIGFAFAPQFHPSYRHAGAVRREIGVPTVFNLLGPLTNPASPRAGLIGCAWADLAEVMAGVFATRG 210 ********************************************************************* PP TIGR01245 208 vkralvvhgedglDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkevle 276 ++ +lvvhg+dglDE+++t++++++++++g++e+ t++p+ fg++ra+++el gg+ae na+ ++vl lcl|NCBI__GCF_000015305.1:WP_083767274.1 211 SS-VLVVHGDDGLDELTTTTTSTIWRVQAGTVERLTFDPAAFGFARAHVSELTGGDAESNAASARAVLG 278 99.*************************************************************97665 PP TIGR01245 277 gkekkakrdivvlNaaaalyvagka.......kdlkegvelakeaiksgkalekleelva 329 g +k++ rd+vvlNaa al++++ +++ g+ +ak+ai+sg+a ++l+++v+ lcl|NCBI__GCF_000015305.1:WP_083767274.1 279 G-AKGPVRDAVVLNAAGALVAHAGLssdakwvPAWESGLARAKDAIDSGAAEQLLARWVR 337 5.56*****************9988788888899***********************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (342 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 11.86 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory