Align isochorismate lyase (EC 4.2.99.21); isochorismate synthase (EC 5.4.4.2) (characterized)
to candidate WP_083769441.1 AFER_RS05650 hypothetical protein
Query= BRENDA::P9WFX1 (450 letters) >NCBI__GCF_000023265.1:WP_083769441.1 Length = 505 Score = 122 bits (306), Expect = 3e-32 Identities = 102/305 (33%), Positives = 144/305 (47%), Gaps = 21/305 (6%) Query: 158 REAIDRLLATGVREVPQS-RSVDVSDDPS--------GFRRRVAVAV----DEIAAGRYH 204 R A+ RL A V + R+ + DDPS GFR A AV I G Sbjct: 189 RAALSRLEADLESAVGRPVRAWPLGDDPSEGVALLDQGFREPFAHAVRLAKQAIDEGEVF 248 Query: 205 KVILSRCVEVPFAIDFPLTYRLGRRHNTPVRSFLLQLGGIRALGYSPELVTAVRADGVVI 264 +V+LS E+ + YR R N +L+ G +G SPE + VR DGVV Sbjct: 249 QVVLSHRFELTTRANPLALYRALRLTNPSPYMYLITDAGGAIVGSSPEALATVR-DGVVW 307 Query: 265 TEPLAGTRALGRGPAIDRLARDDLESNSKEIVEHAISVRSSLEEITDIAEPGSAAVIDFM 324 T P+AG+R G G A D ++L ++ KE EH + V + ++ +A GS V +FM Sbjct: 308 TRPIAGSRPRGSGGASDEALIEELLADPKERAEHLMLVDLARNDVGRVARFGSVVVDEFM 367 Query: 325 TVRERGSVQHLGSTIRARLDPSSDRMAALEALFPAVTASGIPKAAGVEAIFRLDECPRGL 384 V HL S++ +L + AL A PA T SG PK ++ I L+ R + Sbjct: 368 VPERFARVIHLTSSVHGQLTDGVGPIDALAATLPAGTLSGAPKVRAMQLIDELESKRRVV 427 Query: 385 YSGAVVMLSADGG------LDAALTLR-AAYQVGGRTWLRAGAGIIEESEPEREFEETCE 437 Y G V + DG +D A+ +R A + GR L+AGAGI+ S+PERE E Sbjct: 428 YGGVVGYVGRDGTDPESAVMDFAIAIRTAVWLENGRVLLQAGAGIVAGSDPEREATECVA 487 Query: 438 KLSTL 442 K + + Sbjct: 488 KAAAV 492 Lambda K H 0.319 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 604 Number of extensions: 36 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 450 Length of database: 505 Length adjustment: 33 Effective length of query: 417 Effective length of database: 472 Effective search space: 196824 Effective search space used: 196824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory