Align serine O-acetyltransferase (EC 2.3.1.30) (characterized)
to candidate WP_083780027.1 BTUS_RS04450 NeuD/PglB/VioB family sugar acetyltransferase
Query= BRENDA::A0A0H2UNY1 (205 letters) >NCBI__GCF_000092905.1:WP_083780027.1 Length = 257 Score = 45.4 bits (106), Expect = 9e-10 Identities = 40/112 (35%), Positives = 52/112 (46%), Gaps = 8/112 (7%) Query: 65 IEIHPGAQIDSGVFIDHGS----GLVIGETAIVEKGVLLYHGVTLGG-TGKDCGKR---H 116 I++H I G I G +VIG+ IV + H LG + G R + Sbjct: 137 IDVHRSVNIGEGSIICPGVILTVNVVIGKFVIVNVASSISHESKLGDFSSVMTGVRISGN 196 Query: 117 PTVRKGALISAHAQVIGPVEIGENAKVGAAAVVVADVPSDVTVVGIPAKIVR 168 + GA I + A V+ +GE A VGA AVV DV V VGIPA+I R Sbjct: 197 CRIGHGAYIGSGAVVLQGRAVGEAAVVGAGAVVTRDVEPRVVSVGIPARIQR 248 Lambda K H 0.319 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 205 Length of database: 257 Length adjustment: 23 Effective length of query: 182 Effective length of database: 234 Effective search space: 42588 Effective search space used: 42588 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory