Align aspartate transaminase (EC 2.6.1.1) (characterized)
to candidate WP_083780753.1 BBTA_RS02905 aspartate/tyrosine/aromatic aminotransferase
Query= BRENDA::W0PFQ7 (399 letters) >NCBI__GCF_000015165.1:WP_083780753.1 Length = 399 Score = 355 bits (910), Expect = e-102 Identities = 175/387 (45%), Positives = 248/387 (64%) Query: 12 PRDPILGLNEQYNADTRDTKVNLGVGVYYDDNGKIPLLKAVQEAERQRVEAHAARGYLPI 71 P D ++ + D R KVNLG+G+YYD+ G+IP L AV+EA+ + + YLP Sbjct: 9 PPDAVMLAARLFAEDPRPHKVNLGIGMYYDEEGRIPQLAAVREADHRLRSRNRPWPYLPA 68 Query: 72 EGIGNYNKGAQELLFGKDSDVITQGRALTFQALGGTGALKIGADFLKQLQPDSTVYISDP 131 EG+ + A ++FG+D + R Q +GGTGA++IGA+ + + PD+ ISDP Sbjct: 69 EGLVDLKNKAMPVVFGEDQADDLRRRTAWIQTVGGTGAVRIGAELARAIAPDAMASISDP 128 Query: 132 SWENHRALFERAGFKVETYSYYDAATHGLNFDGFAASVKAMPEGSIIVLHACCHNPTGVD 191 SW NH A+F G +V +Y YYD + ++ DG + +P G+++VLH CCHNPTG D Sbjct: 129 SWPNHEAIFRAVGARVSSYRYYDVESCNIDVDGMLQDLGRLPRGTVVVLHGCCHNPTGFD 188 Query: 192 PSPEQWQQIATLVKERNLVPFLDIAYQGFGAGLQEDAAVVRLFADLGMSMFISSSFSKSF 251 P+P QW IA ++ +R L+PF+D+AYQGFG GL+ DA VR+ A +F+S SFSKSF Sbjct: 189 PTPAQWNHIAQVLADRGLIPFIDLAYQGFGEGLEADAQSVRIIAQSCNLIFVSVSFSKSF 248 Query: 252 SLYGERVGALTVVTSSTDEASRVLSQIKRVIRTNYSNPPTHGGMVVAQILNTPELFAQWE 311 SLYGERVG L VVT S +A+ V + + V R YS+ P++G +++A++L P+L W Sbjct: 249 SLYGERVGLLFVVTESEAQAALVGERARAVSRALYSSAPSNGALLIAEVLGDPQLKTTWI 308 Query: 312 SELAQMRDRIREMRKQLTDKLNAAGVKQDFNFVMAQRGMFSYSGLTKEQVERLRTEHGIY 371 EL MR RI MR +L D+L +F + AQRG+FSYSGLT+ ++ERLR +H ++ Sbjct: 309 DELDAMRRRILLMRAELVDQLAGGNRGANFAPIKAQRGLFSYSGLTRTEIERLRVDHAVH 368 Query: 372 AVNSGRICVAALNSRNIDSVVKAIAAV 398 AV GRIC+AALN+ N+ SV AI V Sbjct: 369 AVADGRICLAALNAGNLPSVAAAIRQV 395 Lambda K H 0.318 0.134 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 399 Length of database: 399 Length adjustment: 31 Effective length of query: 368 Effective length of database: 368 Effective search space: 135424 Effective search space used: 135424 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory